KEGG   Acinetobacter baumannii AB0057: AB57_2548Help
Entry
AB57_2548         CDS       T00793                                 

Definition
delta-9 acyl-lipid desaturase 1 (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AB57_2548
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AB57_2548
Enzymes [BR:abn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AB57_2548
Lipid biosynthesis proteins [BR:abn01004]
 Desaturase
  First
   AB57_2548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2642700..2643671)
Genome map
AA seq 323 aa AA seqDB search
MSKFFLRWIDSWSDSENAQVGASSEYVIEKKIQWLRIIPFILLHIACLAAFWVGVSWFAV
IFMLGFYFLRMFAITAFFHRYLSHKTFQTSRIVQFIFVLIGTMSAQRGPLWWAAHHRYHH
HFTDTDQDPHSAKAGFWYSHVGWFLNEQNFATRKKVIKDWLKYPELIWLDRFSLPIVILT
ALAIYGLGSWLAQHFPELGTNGLQLLVWGFVISTVLLTHATLCINSLAHRYGSREFNTPD
DSRNNFLLSLITLGEGWHNNHHFYAGSVRQGFYWWQIDITFYVLKLMSLFGLVWGLKPVP
DKVYQYKKIKNLSIEKIENGEVL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattttttctgcgctggatcgatagctggtcagattcagaaaatgcgcaagtg
ggtgcttctagcgaatatgtcattgaaaagaaaattcaatggttaagaattattcctttt
attttattacatatcgcttgtttagctgcattttgggtgggcgtatcttggtttgctgtg
atcttcatgctggggttttattttcttcgcatgtttgcaattactgcttttttccaccgc
tatctttcgcataaaacttttcagacatcacgtattgttcaattcatttttgtactgatc
ggaaccatgagtgcgcagcgcggacctttatggtgggcagcccatcaccgttatcaccat
cactttaccgacaccgatcaggacccgcattcagcaaaagcaggcttttggtattcgcat
gtaggctggtttttaaatgagcaaaattttgctactcgaaaaaaagtcattaaagactgg
ttgaaatatccagagctgatttggctagaccgatttagtttgcctattgtgattttgacg
gccttagcaatttatggattaggttcatggcttgcacaacatttccctgagttgggcacc
aatggtttacagcttttagtgtggggatttgtgatttccactgttctattaacacatgca
accttgtgtattaattcactcgctcatcgttatggttcacgtgagtttaacaccccagat
gatagccgtaataacttcctactttctttaattaccttgggtgaaggatggcataacaat
catcacttttacgcaggcagtgtgcgtcaaggtttttattggtggcagatagatatcact
ttttatgtgctcaagctgatgtctttatttggtttagtgtggggcctaaagcccgtacca
gacaaggtttatcaatataaaaagattaaaaacctatcgatagaaaaaattgaaaacggt
gaagtgttatga

DBGET integrated database retrieval system