KEGG   Acinetobacter baumannii AB0057: AB57_2671Help
Entry
AB57_2671         CDS       T00793                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
abn  Acinetobacter baumannii AB0057
Brite
Enzymes [BR:abn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     AB57_2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2760640..2761194)
Genome map
AA seq 184 aa AA seqDB search
MTTKPFFDAARVIAGGKLTQAQVDDLNKVVEKLAPGGKTTSDDGIDLITSFEGTRFNAYD
DGVGVWTIGTGTTVYPNGVKVKKGDTCTAEQAKTYFKHDLAKFEKTVNESVTAPLTQNQF
DALVSLTYNIGSGAFNNSTLLKKLNKGDYQGAADQFLVWNKAGGKVMKGLVRRREAERAL
FLKK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacaactaaaccattcttcgatgctgcccgagtaattgcaggcggcaagcttacacag
gcgcaagtagacgatctaaataaagtggtcgaaaaacttgcaccaggtggaaaaactaca
agtgatgatggtatagatttaataactagttttgaaggcacgcgattcaatgcttacgat
gatggtgtaggggtttggaccattggtactggcaccacagtttatccaaatggcgtgaag
gtcaagaagggcgatacttgcacagcagaacaagctaagacttactttaaacatgacttg
gctaaattcgaaaagacagttaatgaatctgtgacagcgcctttaactcaaaatcaattt
gatgctttggtatcgctgacttacaacattggctcaggtgcttttaataattcaacctta
ttaaaaaaactgaataaaggtgactatcaaggcgctgctgatcaattccttgtctggaat
aaggcaggcggtaaagtcatgaaaggtctagttcgtcgccgagaagcagagcgagcactc
tttttaaagaagtaa

DBGET integrated database retrieval system