KEGG   Acinetobacter baumannii AB0057: AB57_2790Help
Entry
AB57_2790         CDS       T00793                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01130  Biosynthesis of antibiotics
abn01230  Biosynthesis of amino acids
Module
abn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AB57_2790
Enzymes [BR:abn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AB57_2790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACJ42140
UniProt: B7I441
Position
2870189..2870995
Genome map
AA seq 268 aa AA seqDB search
MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALQHKRPGVIAEI
KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR
KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA
LKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH
SFLVGESFMKQPRPDQAFTALFGQPQTV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgattaatattcaaaataccattttaggtaaaattgttgaccgtaaacatgaggaactt
gctgcgcgtttaaaacaacgtaatttgcaagatgtagaagagcttgcaaaagcagcgact
ccggtgcgtggctttgcaaatgctttacaacataaacgtccgggcgtgattgctgaaatt
aaaaaagcatctccatcaaaaggaatcattcgcgcagactttaatcctgccgaaattgct
cagcaatatgaacaagctggagcagcatgtttatcggtattgaccgatgttgatttcttt
cagggtgcagatgaaaatattgcgattgcccgtaatcattgtgccctacctgctttacgt
aaagactttttggtcgacccgtacaatgtagttgaagcacgtgctttgcatgctgactgt
attttattaattgttgcttgtttgtctgaccagcaactcgaagaaatgtctaaaactgcg
tttgagcatcaacttgatgtattggttgaagttcatgacgaagaagagttagagcgtgcc
ttaaagctttctgagcaatgtttattaggcgtaaataaccgtaatttaaaaacctttgat
gtagatttaaatactactattcggttgaaaaaattacttccggcctcacgtttattgatc
actgaaagtggtattgcgacaccagatgatgtacgtatgatgcaagagcatgatattcac
agtttcttggttggcgaaagttttatgaaacaaccacgtccagatcaagcttttactgcc
ctttttggacaacctcaaacggtttaa

DBGET integrated database retrieval system