KEGG   Acinetobacter baumannii AB0057: AB57_2795Help
Entry
AB57_2795         CDS       T00793                                 

Definition
(GenBank) GTP cyclohydrolase I FolE
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00790  Folate biosynthesis
abn01100  Metabolic pathways
Module
abn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AB57_2795
Enzymes [BR:abn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AB57_2795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF OmpH Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-ProteinID: ACJ42145
Position
2876834..2877388
Genome map
AA seq 184 aa AA seqDB search
MSMQQSYANILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVFPSDNHE
MVLVKNIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQ
IAEAVAEVTDARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFLSAV
PESY
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgcagcaatcgtacgcaaatattctgactgccgtcggtgaagaccttaatcgt
cccggccttaaagatacgcctgtgcgtgcggctaaagctttttcatatttaacttctggc
tatagtaaaactttagaagaagtcaccaataatgctgttttcccatcagataaccatgaa
atggtattggtgaagaatattgaattttattcgctctgcgaacatcatcttctcccattc
tatggccgtgttcatgttgcctatttaccagaaggcaaagttcttggcttatctaaattt
gcacgtattaccgagatgtttgctcgtcgtttgcaaattcaggaaaacctgactcagcaa
atcgctgaagctgttgcagaagtcactgatgctcgcggtgtcgctgtagttatcgattca
gcacatatgtgtatgatgatgcgtggtgtaggtaaacaagaatctaccactcgtacagtt
tcatttgtcggagattttaaaaccgataaagaagcgcgccgtgaattcttaagtgcagta
ccagaaagctactaa

DBGET integrated database retrieval system