KEGG   Acinetobacter baumannii AB0057: AB57_2795Help
Entry
AB57_2795         CDS       T00793                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2872585..2873139
Genome map
AA seq 184 aa AA seqDB search
MSMQQSYANILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVFPSDNHE
MVLVKNIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQ
IAEAVAEVTDARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFLSAV
PESY
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgcagcaatcgtacgcaaatattctgactgccgtcggtgaagaccttaatcgt
cccggccttaaagatacgcctgtgcgtgcggctaaagctttttcatatttaacttctggc
tatagtaaaactttagaagaagtcaccaataatgctgttttcccatcagataaccatgaa
atggtattggtgaagaatattgaattttattcgctctgcgaacatcatcttctcccattc
tatggccgtgttcatgttgcctatttaccagaaggcaaagttcttggcttatctaaattt
gcacgtattaccgagatgtttgctcgtcgtttgcaaattcaggaaaacctgactcagcaa
atcgctgaagctgttgcagaagtcactgatgctcgcggtgtcgctgtagttatcgattca
gcacatatgtgtatgatgatgcgtggtgtaggtaaacaagaatctaccactcgtacagtt
tcatttgtcggagattttaaaaccgataaagaagcgcgccgtgaattcttaagtgcagta
ccagaaagctactaa

DBGET integrated database retrieval system