KEGG   Acinetobacter baumannii AB0057: AB57_3123Help
Entry
AB57_3123         CDS       T00793                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AB57_3123
   00640 Propanoate metabolism
    AB57_3123
   00660 C5-Branched dibasic acid metabolism
    AB57_3123
Enzymes [BR:abn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AB57_3123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3249697..3250863)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALLKEYGMPVQEGILATNADEAVAAFEQLGGKFAVMKAQVHAGGRGKAGGV
KVAKSKEDVIEFANNIIGTRLVTYQTDANGQPVNSIIVAEDVYPVERELYLGAVVDRSSR
RITFMASTEGGVEIEKVAEETPEKIIKVEVDPLVGLQPFQAREVAFALGLKDKQIGQFVK
IMTAAYQAFVENDFALFEINPLSVRENGEILCVDAKVGIDSNALYRLPKVAALRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYGGQPANFLDVGGGATKERVI
EAFKIILADTSVQGVLINIFGGIVRCDMIAEAIIAAVQEVNVTVPVVVRLEGNNAELGAK
LLDESGLKLISANGLSDAAEKVVAAVKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaagctaaagcgttattgaaagaatatggtatgccggtacaa
gaaggtatcttggcaaccaatgcagacgaagcagttgctgcatttgaacagcttggtggt
aaattcgctgtaatgaaggcgcaagttcatgctggtggtcgtggtaaggctggtggcgtt
aaagttgcaaaatctaaagaagatgttatcgaatttgcaaacaatatcattggtactcgt
cttgtaacgtatcaaacagatgcaaatggtcaaccagtaaacagcatcattgttgctgaa
gacgtatatccagttgagcgtgagctttacttgggcgcggttgtagaccgttctagccgt
cgtattactttcatggcttctacagaaggtggtgtagaaatcgagaaagttgcggaagaa
actccagaaaaaattatcaaagttgaagttgatccattagttggtttacaaccattccaa
gcacgtgaagttgcgtttgctttaggtttgaaagacaagcaaatcggtcaattcgtgaaa
atcatgacagctgcttaccaagcatttgttgaaaatgatttcgctttatttgaaattaac
ccactttcagttcgtgaaaatggcgaaattttatgtgtagacgcgaaagtaggtatcgac
tctaacgcgctttaccgtttacctaaagttgctgctttacgtgacaaatctcaagagaat
gagcgtgaattaaaagcatctgaatttgatcttaactatgttgctttagaaggtaacatt
ggctgtatggttaacggtgctggtcttgcaatggcaactatggacatcattaaactttat
ggtggtcagcctgcaaacttccttgacgttggtggcggtgcaactaaagagcgtgtaatc
gaagcgttcaaaatcattcttgctgatacgtctgtacaaggtgttttaatcaacatcttc
ggtggtatcgtacgttgtgacatgattgctgaagcaattattgcagcggttcaagaagta
aacgtaactgttccagttgttgttcgtttagaaggtaacaacgctgagttaggtgcgaaa
ttacttgatgaatctggtttgaaattaatttctgcgaacggtttgtctgatgccgcagaa
aaagttgtagctgcagttaaagcgtaa

DBGET integrated database retrieval system