KEGG   Acinetobacter baumannii AB0057: AB57_3373Help
Entry
AB57_3373         CDS       T00793                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AB57_3373 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB57_3373 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AB57_3373 (trpA)
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AB57_3373 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3478679..3479482)
Genome map
AA seq 267 aa AA seqDB search
MSRLATRFEKLQSQQRKALVSYVMAGDPQPQVTVPLLHKMVAAGVDVIELGLPFSDPMAD
GPVIALAAERALAAGTNTLDALNMVKEFREQDQETPVVLMGYLNPVEVIGYEKFVSYAKQ
CGVDGLLLVDLPPEESKEFGAILKQHDMDQIFLLAPTSTDQRIQHVANQASGFIYYVSLK
GVTGAATLDTSEAAARIEKIKGMTNVPVGVGFGISDAASAKAMGSVADAVIVGSAFVKSF
ATLAADEAVEQTVNKVKELRAALDELV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcttgccacccgttttgaaaagctgcagtcccaacaacgtaaagcgcttgta
tcttatgtcatggcgggtgatccacagccacaagtaacggtgccgttacttcataaaatg
gttgcggcaggagtagacgtcattgagcttggtttaccattttcagacccgatggctgat
ggtccggtaattgcacttgctgctgaacgcgcacttgcggctgggacgaacaccttagat
gcgctgaacatggtaaaagagtttcgtgagcaggatcaggaaacacctgtagttttaatg
ggttatcttaatcctgttgaagtgattggttacgagaagtttgtttcttatgcgaaacaa
tgtggtgtagatggcttattacttgtggacttaccaccggaagagtcaaaagaatttggt
gcaatcttgaaacaacatgatatggatcagattttcttacttgcaccaacttcaactgat
caacgtattcaacacgtagcgaatcaggcaagcgggtttatctactatgtttcactcaaa
ggtgtaacaggtgcagcgactttggatacttctgaagcggctgcacgtattgaaaaaatc
aaaggtatgactaacgttccagttggcgttggtttcggaattagtgatgctgcttcagcg
aaagcgatgggtagtgttgcagatgccgtgattgtaggtagtgctttcgttaaatctttt
gcaacgttggcagctgatgaagctgttgaacagacggtgaataaagtcaaggagcttcga
gcagcgctcgatgagttagtatga

DBGET integrated database retrieval system