KEGG   Acinetobacter baumannii AB0057: AB57_3379Help
Entry
AB57_3379         CDS       T00793                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AB57_3379 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB57_3379 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AB57_3379 (trpB)
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AB57_3379 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3483337..3484566)
Genome map
AA seq 409 aa AA seqDB search
MDQQNNMIDYTQFPDANGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQFLAEFDRDL
AYYVGRPSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIA
ETGAGQHGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVVPVQSGSKTLKD
AMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQILEQAGRLPDALV
ACVGGGSNAMGLFYPFLNDANVKMYGVEAAGFGIETGKHSAPLNAGHVGVLHGNRTYLMS
DEQGQIIETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTEALQGFRDLTKIEGIIPA
LESSHAMAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVEMVEM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagcaaaataatatgattgactatacccaattcccagatgcaaatgggcatttc
ggtatccatggcggacgttttgtgtcagaaactttaatggcggcattagaagatttggaa
aatctctattcccgcatgaaaaatgatgaacagtttttggcagaattcgaccgtgacctc
gcctactatgtaggtcgtcctagtccactttattatgctgagcgatggtcaaaagagtta
ggtggtgcgcaaatttaccttaaacgtgaagacttgaaccatactggctcacacaaggta
aacaacacgattggtcaggcgttattggcaaagctttctggtaaaaaacgtattattgcc
gaaactggtgcagggcagcatggtgtagcgacagcaacaattgcagcacgtttaggtctt
gaatgtgttgtttatatgggtgctgaagacgttaagcgtcaagcgatgaacgtttaccgt
atgcgtttgttaggcgctacagttgttcctgtacaaagtggctctaaaacgttgaaagac
gccatgaacgaagcgatgcgtgactgggtaactaatgttgatacgacgtactatgtgatt
ggtacggttgcaggcccgcatccatatcctcaattggttcgtgacttccagtcgattatt
ggtcgtgaagcgcgtaaacagattttggaacaagcaggtcgtttaccagatgcattagtt
gcctgtgtaggtggcggttcaaatgcaatgggcttgttctatccgtttttaaacgatgcc
aatgtgaaaatgtatggtgttgaagccgctggttttggtattgaaactggtaaacactct
gcgccgttaaatgcgggtcatgtgggtgtattgcacggtaaccgtacttacttgatgagt
gatgaacaaggccagattattgagacacatagtatctcagcaggtcttgactatccgggt
gttggccctgaacatagcttcttgaaagatatgaagcgtgtagagtacgtgccgattaat
gatacagaagctctacaaggtttccgcgacttaactaaaatcgaagggattattcctgca
cttgaaagctcgcatgcgatggcctatgtctctaagcttgcaccgacgatgtctaaagat
cagattattattgcgactgtttcaggtcgtggtgataaagatttaatgacagttgcacgt
attgatggcgtagaaatggtcgagatgtaa

DBGET integrated database retrieval system