KEGG   Acinetobacter baumannii AB0057: AB57_3534Help
Entry
AB57_3534         CDS       T00793                                 

Definition
hypothetical protein
Orthology
K06915  
 
Organism
abn  Acinetobacter baumannii AB0057
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3638288..3639835
Genome map
AA seq 515 aa AA seqDB search
MGTPIVIAKNINDTSKEIVLLSQFANRHGLIAGATGTGKTVTLKVLAESFSRIGVPVFLA
DAKGDVSSLAKAGEASDKFNERLKLLQIDSVPFAANPVVFWDLFGQQGHPIRTTISEIGP
ILLARILNLNDTQEGVLSAVFRIADDQGLLLVDFKDLKAMITFVSEHAAEFKAEYGNLSP
ASLGAIQRNLLALADQGGEQFFGEPALNILDFIQTDANGHGYINILAADKLMNTPKLYAT
FLLWMLSELFEQLPEVGDMDKPKLVFFFDEAHLLFDNASQALQEKIEQVVRLIRSKGVGI
YFITQNPLDLPESVLGQLGNRVQHALRAFTPKDQKAVKTAADTFRSNPDFKVDEAITELG
VGEALISCLDEQGTPQIVERGWVMPPYSSFTPITPEERQTFNSQSIIAGVYEQAVDRDSA
YEMLQNKVAEREQQKQDAELAKQQAKEQETLAKQQAKEQERLAREQQKEEERAARERAKL
TQDIVGTFAKSAARSLGGSTGQKLVRGLLGSLFGK
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaccgattgttattgcaaaaaatattaacgacacatcaaaagaaattgtttta
ctttcccaatttgccaaccggcacggcctgattgcaggtgcgaccggtacaggtaaaaca
gtcaccctaaaggtgctcgcagagagtttttctcgaatcggcgttcccgtctttcttgcc
gacgcaaaaggtgatgtttcaagcctcgcaaaagctggtgaagcttcggataaatttaat
gaacgcttaaagcttttacagatcgacagtgttccatttgcagccaatccagttgttttc
tgggatttatttggtcagcaaggccaccctattcgaaccactatttctgaaattggacca
attttattagcacgtatactcaacttgaatgacacccaagaaggtgttttatctgccgta
ttccgtattgcagacgaccaaggattacttctggtcgactttaaagatttaaaagccatg
atcacttttgtaagtgaacatgcagctgagtttaaagccgaatatggcaacttatctcca
gccagcttaggcgctattcaacgtaatctccttgctcttgccgaccaaggtggagagcag
ttttttggagagccagctttaaatattctggactttatacaaaccgacgcaaatgggcat
ggttatatcaatattcttgcggctgataagctcatgaatacacctaagctatatgctact
ttcctgttatggatgctttcagaattatttgaacagcttccagaagttggtgatatggat
aaacctaaactcgtgtttttctttgatgaagctcacttgttattcgacaacgccagtcaa
gctttacaagaaaaaattgaacaagttgtacgtttaattcgttctaaaggtgtgggaatt
tattttattacccaaaacccactcgacttaccagaaagtgttttagggcaactcggcaac
cgtgtacaacatgctttacgtgcctttactcctaaagatcaaaaagcagtaaaaacagca
gcagatacattccgctctaatcccgattttaaagtagatgaagcaattaccgagctcggt
gtaggtgaagcactgattagttgtctagatgagcaaggtacacctcaaattgtagagcgt
ggttgggttatgcctccttactcttcatttacacctatcactccagaagagcgtcagacc
tttaattcgcaaagtattattgccggggtttatgaacaagctgtagatcgtgatagtgcc
tatgaaatgctccaaaacaaagtggctgaacgggaacagcaaaaacaagatgcagaactc
gcaaaacagcaagcgaaagaacaggaaactttagcgaaacaacaagccaaagaacaagaa
cgtctagcacgtgaacagcaaaaagaagaggaacgtgcggcgcgtgaaagagctaaactt
actcaagatattgtaggaacttttgcaaaaagtgctgctcgcagcttaggtggtagtact
ggccaaaaattagtacgggggctactcggctcattatttggaaaataa

DBGET integrated database retrieval system