KEGG   Acinetobacter baumannii AB0057: AB57_3875Help
Entry
AB57_3875         CDS       T00793                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AB57_3875
Enzymes [BR:abn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     AB57_3875
    3.5.1.-  
     AB57_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4001198..4001842)
Genome map
AA seq 214 aa AA seqDB search
MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNH
ISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHI
DSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDA
CKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaataaacaaccacaaaattcggctttagtcgtagttgacgtgcaaaatggt
tttacccctggtggaaacctagcagttgccgacgccgatacgattattccaaccattaac
caattggcaggttgttttgaaaatgtagtcctcactcaagactggcatccggataatcac
atttcttttgcagccaaccatccgggcaagcagccatttgaaacgattgaactggattat
ggatcacaggtgctttggcctaagcattgtatacaaggcactcatgatgccgaatttcat
ccggatttaaatatcccgacagctcaactgattatccgaaaaggttttcatgctcatatt
gatagttactcggcttttatggaagccgaccacaccacaatgacaggtttaacgggttac
ttaaaagaacgtggtattgatacggtctatgtggtcggaattgccaccgacttttgtgtc
gcatggactgctttagatgcggttaagcaaggctttaaaactttagtgattgaagatgcg
tgcaagggtattgatcttaatggttcattagaacaagcgtggcaaactatgcagcaacaa
ggtgttgttcgtattcaatcgactgatctgttgaatgaatgctag

DBGET integrated database retrieval system