KEGG   Alcanivorax borkumensis: ABO_0061Help
Entry
ABO_0061          CDS       T00380                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:abo01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:abo00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:abo00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:abo00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:abo00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:abo00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
63683..64639
Genome map
AA seq 318 aa AA seqDB search
MKAIATTGWGLKPTLSLIETDAPGRLKADDVLVAVHAASVNPKDWKLNYNLAVAASPVMV
KQLKPLFGDDLAGIVVDTGPNVSDFEIGDAVYGMDMRLRTASLAELTLIDQRRIAKKPEN
LSFTQAAAMPLAALTALQGLRKGKAEAGKKVLIIGASGGVGSFAVQIAKNLGLHVTGVCS
GRNTDFVRELGADAVIDYTQGDYRHSAGEFDLVFDVTSYETPLTCAALLGKKGYFISTGG
DGKSMLATPLYRLLGKKAGTVVVESYRRDLETLKAMVEAGSLTPVIDSVFTLAESEAAYN
RSRSGRCRGKVVINVANA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatcgctaccaccggctggggcctcaagcccaccctctccctgattgagaca
gatgctccaggacgattaaaagcggatgacgtgctggtggccgtccatgcggcgtcggtt
aaccccaaggattggaagctgaactacaatttggcggtggcagcgagcccggtgatggtt
aaacaactaaagcccctgtttggtgatgacctggcaggcatcgtggtggacacgggtcct
aatgttagtgactttgagatcggtgatgcggtttatggaatggatatgcgcctgcgaacc
gcatcgctggcagagctgaccctgattgatcagcgccgtattgcaaaaaagccggagaac
ctgtcatttactcaagccgccgccatgcctctggccgccctcaccgcgctgcaagggttg
cgtaaagggaaagcggaagcggggaaaaaggtattgattatcggcgcgtctggtggagtg
ggtagtttcgccgttcaaatagcgaaaaacctgggcctgcatgtcaccggtgtgtgcagt
ggtcggaacaccgattttgttcgtgagttaggggcggatgcggtgattgattacacccag
ggggattaccgccattcggcaggtgagttcgatctggtattcgatgtgacatcttatgaa
acgccgctaacgtgtgccgcgctgttgggcaagaagggctacttcatttccactggtggc
gatggcaaatctatgttggccaccccgctctatcggctgttgggcaaaaaagccggcaca
gtggtggtcgaatcttatcggcgtgatctggaaacactaaaggccatggtggaagcgggt
tctttgacaccagtaatcgatagcgtttttacgttggcagagagcgaagcggcctataac
cgcagccgttccggccgctgccggggaaaagtggttattaatgtggctaacgcctga

DBGET integrated database retrieval system