KEGG   Alcanivorax borkumensis: ABO_0061Help
Entry
ABO_0061          CDS       T00380                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ABO_0061
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABO_0061
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_0061
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABO_0061
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABO_0061
   00626 Naphthalene degradation
    ABO_0061
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABO_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
63683..64639
Genome map
AA seq 318 aa AA seqDB search
MKAIATTGWGLKPTLSLIETDAPGRLKADDVLVAVHAASVNPKDWKLNYNLAVAASPVMV
KQLKPLFGDDLAGIVVDTGPNVSDFEIGDAVYGMDMRLRTASLAELTLIDQRRIAKKPEN
LSFTQAAAMPLAALTALQGLRKGKAEAGKKVLIIGASGGVGSFAVQIAKNLGLHVTGVCS
GRNTDFVRELGADAVIDYTQGDYRHSAGEFDLVFDVTSYETPLTCAALLGKKGYFISTGG
DGKSMLATPLYRLLGKKAGTVVVESYRRDLETLKAMVEAGSLTPVIDSVFTLAESEAAYN
RSRSGRCRGKVVINVANA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatcgctaccaccggctggggcctcaagcccaccctctccctgattgagaca
gatgctccaggacgattaaaagcggatgacgtgctggtggccgtccatgcggcgtcggtt
aaccccaaggattggaagctgaactacaatttggcggtggcagcgagcccggtgatggtt
aaacaactaaagcccctgtttggtgatgacctggcaggcatcgtggtggacacgggtcct
aatgttagtgactttgagatcggtgatgcggtttatggaatggatatgcgcctgcgaacc
gcatcgctggcagagctgaccctgattgatcagcgccgtattgcaaaaaagccggagaac
ctgtcatttactcaagccgccgccatgcctctggccgccctcaccgcgctgcaagggttg
cgtaaagggaaagcggaagcggggaaaaaggtattgattatcggcgcgtctggtggagtg
ggtagtttcgccgttcaaatagcgaaaaacctgggcctgcatgtcaccggtgtgtgcagt
ggtcggaacaccgattttgttcgtgagttaggggcggatgcggtgattgattacacccag
ggggattaccgccattcggcaggtgagttcgatctggtattcgatgtgacatcttatgaa
acgccgctaacgtgtgccgcgctgttgggcaagaagggctacttcatttccactggtggc
gatggcaaatctatgttggccaccccgctctatcggctgttgggcaaaaaagccggcaca
gtggtggtcgaatcttatcggcgtgatctggaaacactaaaggccatggtggaagcgggt
tctttgacaccagtaatcgatagcgtttttacgttggcagagagcgaagcggcctataac
cgcagccgttccggccgctgccggggaaaagtggttattaatgtggctaacgcctga

DBGET integrated database retrieval system