KEGG   Alcanivorax borkumensis: ABO_0148Help
Entry
ABO_0148          CDS       T00380                                 

Gene name
ech1
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abo  Alcanivorax borkumensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABO_0148 (ech1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABO_0148 (ech1)
   00650 Butanoate metabolism
    ABO_0148 (ech1)
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_0148 (ech1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABO_0148 (ech1)
   00310 Lysine degradation
    ABO_0148 (ech1)
   00360 Phenylalanine metabolism
    ABO_0148 (ech1)
   00380 Tryptophan metabolism
    ABO_0148 (ech1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABO_0148 (ech1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABO_0148 (ech1)
   00281 Geraniol degradation
    ABO_0148 (ech1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABO_0148 (ech1)
   00627 Aminobenzoate degradation
    ABO_0148 (ech1)
   00930 Caprolactam degradation
    ABO_0148 (ech1)
Enzymes [BR:abo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABO_0148 (ech1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
158544..159398
Genome map
AA seq 284 aa AA seqDB search
MSALPEYRSFDVTVQNFIAHVQFSRPESLNSMNKDFWLELPRCLRDIEASTDARVVVISS
TGKHFSAGMDLAVFSDPSGAPMGGDPGRMAENLRRVVLQLQDCLSVLEQVRIPVLAAIQG
GCIGGALDLVCAADSRYCTEDAFFTIKETPLGMTADVGTLQRLPKLMPQGLVRELAYTGR
KFGAQEAAEQGLVNSVYGNTHDMLAAVMGIAADIAANSPLAVMGCKEMLNYSRDHSVEDS
LKYMATWQAGMFRPDDMMLTFQAQAKKEQAQYPDLMPIKELFES
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgttacctgaataccgctcgtttgatgttaccgtgcaaaattttattgcccac
gtgcaattcagccgtcctgaatcgctgaacagtatgaacaaggatttttggctggagttg
ccccgttgcttgcgggatatagaggcgagcactgatgctcgagtggtggtgatttcttcc
acaggcaaacacttttctgcgggcatggatttggcggtgttttcggatcctagtggtgcc
ccaatgggaggggacccgggacgaatggcagagaaccttcgccgggtggtgctgcagctg
caagattgtctgagtgtgctcgagcaggtgcgaattccagtgctggcagcgattcaggga
ggctgtattggtggcgcattggatttggtgtgtgcggcggacagtcgttactgcacagag
gacgcgttctttaccatcaaggaaaccccgctgggtatgactgcggatgtgggtacactt
cagcgtctgcctaagttgatgccccaaggcctggtgagggagctggcctataccggtcgc
aagtttggcgcccaagaggcggcggagcaagggctggtcaatagtgtttacggtaatacg
catgacatgctagcggccgtgatgggcattgctgcggatatagctgcgaattctccgctg
gcggtgatgggctgcaaggaaatgcttaattacagccgtgaccacagtgttgaggatagc
ctgaaatacatggctacatggcaagcgggtatgttccggcccgacgatatgatgttgacc
tttcaagcccaggcgaagaaagaacaggcgcaatacccggatttgatgcccatcaaagaa
ttgtttgagtcttga

DBGET integrated database retrieval system