KEGG   Alcanivorax borkumensis: ABO_0148Help
Entry
ABO_0148          CDS       T00380                                 

Gene name
ech1
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abo  Alcanivorax borkumensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABO_0148 (ech1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABO_0148 (ech1)
   00650 Butanoate metabolism
    ABO_0148 (ech1)
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_0148 (ech1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABO_0148 (ech1)
   00310 Lysine degradation
    ABO_0148 (ech1)
   00360 Phenylalanine metabolism
    ABO_0148 (ech1)
   00380 Tryptophan metabolism
    ABO_0148 (ech1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABO_0148 (ech1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABO_0148 (ech1)
   00281 Geraniol degradation
    ABO_0148 (ech1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABO_0148 (ech1)
   00627 Aminobenzoate degradation
    ABO_0148 (ech1)
   00930 Caprolactam degradation
    ABO_0148 (ech1)
Enzymes [BR:abo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABO_0148 (ech1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
158544..159398
Genome map
AA seq 284 aa AA seqDB search
MSALPEYRSFDVTVQNFIAHVQFSRPESLNSMNKDFWLELPRCLRDIEASTDARVVVISS
TGKHFSAGMDLAVFSDPSGAPMGGDPGRMAENLRRVVLQLQDCLSVLEQVRIPVLAAIQG
GCIGGALDLVCAADSRYCTEDAFFTIKETPLGMTADVGTLQRLPKLMPQGLVRELAYTGR
KFGAQEAAEQGLVNSVYGNTHDMLAAVMGIAADIAANSPLAVMGCKEMLNYSRDHSVEDS
LKYMATWQAGMFRPDDMMLTFQAQAKKEQAQYPDLMPIKELFES
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgttacctgaataccgctcgtttgatgttaccgtgcaaaattttattgcccac
gtgcaattcagccgtcctgaatcgctgaacagtatgaacaaggatttttggctggagttg
ccccgttgcttgcgggatatagaggcgagcactgatgctcgagtggtggtgatttcttcc
acaggcaaacacttttctgcgggcatggatttggcggtgttttcggatcctagtggtgcc
ccaatgggaggggacccgggacgaatggcagagaaccttcgccgggtggtgctgcagctg
caagattgtctgagtgtgctcgagcaggtgcgaattccagtgctggcagcgattcaggga
ggctgtattggtggcgcattggatttggtgtgtgcggcggacagtcgttactgcacagag
gacgcgttctttaccatcaaggaaaccccgctgggtatgactgcggatgtgggtacactt
cagcgtctgcctaagttgatgccccaaggcctggtgagggagctggcctataccggtcgc
aagtttggcgcccaagaggcggcggagcaagggctggtcaatagtgtttacggtaatacg
catgacatgctagcggccgtgatgggcattgctgcggatatagctgcgaattctccgctg
gcggtgatgggctgcaaggaaatgcttaattacagccgtgaccacagtgttgaggatagc
ctgaaatacatggctacatggcaagcgggtatgttccggcccgacgatatgatgttgacc
tttcaagcccaggcgaagaaagaacaggcgcaatacccggatttgatgcccatcaaagaa
ttgtttgagtcttga

DBGET integrated database retrieval system