KEGG   Alcanivorax borkumensis: ABO_0148Help
Entry
ABO_0148          CDS       T00380                                 

Gene name
ech1
Definition
(GenBank) enoyl-CoA hydratase/isomerase, putative
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00071  Fatty acid degradation
abo00280  Valine, leucine and isoleucine degradation
abo00281  Geraniol degradation
abo00310  Lysine degradation
abo00360  Phenylalanine metabolism
abo00362  Benzoate degradation
abo00380  Tryptophan metabolism
abo00410  beta-Alanine metabolism
abo00627  Aminobenzoate degradation
abo00640  Propanoate metabolism
abo00650  Butanoate metabolism
abo00903  Limonene and pinene degradation
abo00930  Caprolactam degradation
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01212  Fatty acid metabolism
Module
abo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABO_0148 (ech1)
   00650 Butanoate metabolism
    ABO_0148 (ech1)
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_0148 (ech1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABO_0148 (ech1)
   00310 Lysine degradation
    ABO_0148 (ech1)
   00360 Phenylalanine metabolism
    ABO_0148 (ech1)
   00380 Tryptophan metabolism
    ABO_0148 (ech1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABO_0148 (ech1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABO_0148 (ech1)
   00281 Geraniol degradation
    ABO_0148 (ech1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABO_0148 (ech1)
   00627 Aminobenzoate degradation
    ABO_0148 (ech1)
   00930 Caprolactam degradation
    ABO_0148 (ech1)
Enzymes [BR:abo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABO_0148 (ech1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAL15596
UniProt: Q0VTC4
Position
158544..159398
Genome map
AA seq 284 aa AA seqDB search
MSALPEYRSFDVTVQNFIAHVQFSRPESLNSMNKDFWLELPRCLRDIEASTDARVVVISS
TGKHFSAGMDLAVFSDPSGAPMGGDPGRMAENLRRVVLQLQDCLSVLEQVRIPVLAAIQG
GCIGGALDLVCAADSRYCTEDAFFTIKETPLGMTADVGTLQRLPKLMPQGLVRELAYTGR
KFGAQEAAEQGLVNSVYGNTHDMLAAVMGIAADIAANSPLAVMGCKEMLNYSRDHSVEDS
LKYMATWQAGMFRPDDMMLTFQAQAKKEQAQYPDLMPIKELFES
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgttacctgaataccgctcgtttgatgttaccgtgcaaaattttattgcccac
gtgcaattcagccgtcctgaatcgctgaacagtatgaacaaggatttttggctggagttg
ccccgttgcttgcgggatatagaggcgagcactgatgctcgagtggtggtgatttcttcc
acaggcaaacacttttctgcgggcatggatttggcggtgttttcggatcctagtggtgcc
ccaatgggaggggacccgggacgaatggcagagaaccttcgccgggtggtgctgcagctg
caagattgtctgagtgtgctcgagcaggtgcgaattccagtgctggcagcgattcaggga
ggctgtattggtggcgcattggatttggtgtgtgcggcggacagtcgttactgcacagag
gacgcgttctttaccatcaaggaaaccccgctgggtatgactgcggatgtgggtacactt
cagcgtctgcctaagttgatgccccaaggcctggtgagggagctggcctataccggtcgc
aagtttggcgcccaagaggcggcggagcaagggctggtcaatagtgtttacggtaatacg
catgacatgctagcggccgtgatgggcattgctgcggatatagctgcgaattctccgctg
gcggtgatgggctgcaaggaaatgcttaattacagccgtgaccacagtgttgaggatagc
ctgaaatacatggctacatggcaagcgggtatgttccggcccgacgatatgatgttgacc
tttcaagcccaggcgaagaaagaacaggcgcaatacccggatttgatgcccatcaaagaa
ttgtttgagtcttga

DBGET integrated database retrieval system