KEGG   Alcanivorax borkumensis: ABO_0178Help
Entry
ABO_0178          CDS       T00380                                 

Gene name
gmk-2
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00230  Purine metabolism
abo01100  Metabolic pathways
Module
abo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABO_0178 (gmk-2)
Enzymes [BR:abo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ABO_0178 (gmk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_16 AAA_25 MMR_HSR1 RsgA_GTPase AAA_18 ABC_tran MobB AAA_26 cobW AAA_23 AAA_35 AAA
Motif
Other DBs
NCBI-ProteinID: CAL15626
UniProt: Q0VT94
Position
complement(187269..187892)
Genome map
AA seq 207 aa AA seqDB search
MADKGTLYIISAPSGAGKTSLVAALVDKLAQVRISISHTTRAMRPGEKDGVNYHFTDRDC
FVRQVEQGRFLEHAQVFGNLYGTSADWVAQTLRTGDDVILEIDWQGATQIRKQLPDSVSI
FILPPSLEALAGRLRGRETDDETVIQQRLDGAQEEMSHYGEFDYLVVNDDFQRALYELEA
IVEARRLVTARQVARQAATLQNLLARR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaaggcacgctgtacatcatttccgccccgtccggcgccggcaaaaccagc
ctggtggccgcactggtcgacaagcttgcccaggtacgcatttccatttcgcacaccacc
cgggccatgcgccccggtgaaaaagacggcgtgaactaccacttcaccgaccgcgactgt
tttgtgcgccaggtggagcagggtcgttttctggaacatgcgcaagtgttcggcaatctc
tacggcaccagcgctgactgggtagcccagaccctgcgcaccggcgacgatgtcattctg
gagattgactggcaaggcgccacccaaatacgcaaacagctcccggattcagtcagcatc
ttcattcttccgccctccctggaggcactggctggccgcctgcgcggccgggaaaccgac
gacgaaacggttattcagcaacgcctagacggcgcccaagaagagatgagccactacgga
gaattcgattatctggtggtcaacgatgacttccagcgtgccctttatgagctggaagcc
attgtcgaagctcgccggctggtgacagcacgacaggtcgcgcgccaagccgccaccctg
cagaacctgctcgcccggcgctga

DBGET integrated database retrieval system