KEGG   Alcanivorax borkumensis: ABO_0211Help
Entry
ABO_0211          CDS       T00380                                 

Gene name
pgm
Definition
phosphoglucomutase/phosphomannomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABO_0211 (pgm)
   00030 Pentose phosphate pathway
    ABO_0211 (pgm)
   00051 Fructose and mannose metabolism
    ABO_0211 (pgm)
   00052 Galactose metabolism
    ABO_0211 (pgm)
   00500 Starch and sucrose metabolism
    ABO_0211 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    ABO_0211 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    ABO_0211 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABO_0211 (pgm)
Enzymes [BR:abo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ABO_0211 (pgm)
    5.4.2.8  phosphomannomutase
     ABO_0211 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(228475..230829)
Genome map
AA seq 784 aa AA seqDB search
MKQLLPLVTAGIIGVIAATGCLYVYQIKQLQPEQQHTQAQLLARSLANQVHSTIEISRKQ
LDILSNRRDANRALADNDLSSFNMHQQQWFPEASVQLISHRDSDMSRLSYTAQELLKKAS
LGQKPEPVIIAGDIPRLVIARATHNEFGSLLLTQSLVPLATALRASIPNGGALAVKYAGT
PLLNNKQRASGGTAQVTQGPVEVSLALRAHSDNSLIVAILGVSLGAVAILLTTLLVNRLL
NRALRQDVAELIRYSDELIHQPGVTARDHFQFPVLKGANEASARLAQKLRERAGATRPHA
AAQTDALLVEENDDDSILLIDDDGGDQAVPDSIFRAYDIRGIAGDTLTAQGTYLLGRAIG
SEAGELGQQTVLVARDGRLSSPELSRSLIKGLLESGRDVVNLGLVPTPVLYYATEVLETQ
TGIMLTGSHNPPQHNGLKIVMNGDTLYGERILALSQRIKNNAFSEGRGHEEERDIADRYL
NDIASDIVLARPLKIAIDCGNGATGELAPRLFSQLGCEVAPLYTEIDGNFPNHAPDTGNP
DNLTDLIRVVQEQELDLGLAFDGDGDRVAVVTNTGEIIWPDRLLMLFAKDLLARSPGADI
LFDVKCSRALPAIIRKNGGRPLMYKTGHSLIKAKMKESGTALAGEISGHIFFADRWFGCD
DGAYAGARLLEILSLQDDTAGQVFDQFQTGATTPALYIDATDDNKFALIDALEAHADQFT
GGRPTTIDGLRVDFPDGWGLVRASNTTPSLVARFEGRDEEALERVKEQFRKQLHAIDKSL
KLPF
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgctgcccttggttacagcgggcattatcggggtaattgcggccaccggc
tgcctttacgtctatcaaataaagcaattacaacccgaacaacagcatactcaggctcaa
ttgttggctcgctctttggccaatcaagtccatagcacgatcgagatatcacgtaagcaa
ctggacattctcagtaaccgccgcgacgcaaaccgcgctctggcagacaatgacctgtcc
agcttcaacatgcatcagcagcaatggttccccgaagcctcagtccagttaatttcccac
cgtgattcagatatgtcccggctcagctacacggcccaagagctactcaagaaggccagc
ttgggccaaaagcccgagcccgtcatcattgccggcgacataccccggctagtgatcgct
cgcgccacccacaacgaatttggcagcctactgctcacccagtccttagttccgctggct
accgccctgcgcgcgtctatcccaaacggtggtgcgctcgccgtgaaatacgctggcacc
cctctgctcaacaacaagcaacgcgccagcggcggcaccgctcaggtcacgcaaggcccg
gttgaagtcagcctagcactacgcgcgcacagcgataatagcctgattgtcgccatcctt
ggcgtctccctgggtgcagttgccatcctcctaaccaccctgctggtcaaccgcctgctg
aaccgagccctgcgacaagacgtcgccgagctaatccgctacagcgacgaactcatacac
caaccgggtgtcaccgcccgcgaccatttccagtttccagttttaaaaggcgctaacgaa
gcctccgcccggctggcccaaaaattacgcgagcgcgcaggcgccactcgtccccatgcc
gcagcccaaaccgacgccttgctagtggaggaaaatgacgacgatagcattctactaata
gatgacgatggcggtgaccaagctgtacccgacagcatttttcgcgcttacgacatccgc
ggcatagccggcgacaccctaaccgctcaaggcacctacctgctaggacgcgccatcggc
agcgaagccggcgaactgggccagcaaacagtgctggtggcccgcgatggccgcctttcc
agcccggaactcagccgctcattaatcaaaggcctgctagaatccggccgcgacgtggtt
aacctgggcctagtccccactccggttctctactatgccaccgaagtactagaaactcag
accggcatcatgctcaccggcagccacaacccgccccagcataacggcctaaaaatcgtc
atgaacggcgacactctttacggcgaacgcatcctagcccttagccagcgcatcaaaaac
aatgcctttagcgaaggccgcggccacgaagaagaacgcgacatcgccgatcgctatctc
aacgacattgccagcgacatcgtgctggcccgccccctaaaaattgccatcgactgcggc
aacggtgccactggcgaactggcgccacgcctgttcagccagttaggatgtgaagttgcg
ccactgtatacagagatcgacggaaacttccccaaccacgccccagacaccggtaacccg
gataacctcaccgacctgatccgcgtagtacaggaacaggaactggacctgggcctagcc
ttcgatggcgacggcgaccgcgtcgcagtggttaccaacaccggcgaaatcatctggccc
gatcgcctgctaatgctgttcgccaaagacctgctcgcccgcagccccggcgccgacatc
cttttcgacgtaaaatgcagccgcgccctgcctgccattatccgcaagaacggaggccgt
ccattgatgtacaaaacagggcactcgctaatcaaggccaaaatgaaagaaagtggtacc
gccttggcgggtgaaatcagcggccacatcttcttcgccgaccgctggttcggctgcgat
gacggcgcctatgcgggagctcgcctgctggaaatcctttcattgcaagatgacaccgcc
ggccaagtattcgaccaatttcaaaccggcgccaccaccccagcgttgtatatcgatgcc
accgacgacaacaaatttgcactgatcgacgccctcgaggcccatgccgaccaattcacc
ggcggccgccccaccaccatcgacgggctacgggtggactttcctgatggctgggggctg
gtgcgcgcgtccaacaccaccccgtcactggtggcccgcttcgaagggcgcgacgaagag
gcactggaacgagtaaaagaacagttccgcaaacaactgcatgcaatcgataaaagccta
aaattgccgttttga

DBGET integrated database retrieval system