KEGG   Alcanivorax borkumensis: ABO_0280Help
Entry
ABO_0280          CDS       T00380                                 

Gene name
cysQ
Definition
inositol 1-phosphatase (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
abo  Alcanivorax borkumensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:abo00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
305004..305825
Genome map
AA seq 273 aa AA seqDB search
MEMTDLNALLGPLGEIARAAGQAILEVYERDDLGVETKDDKSPITEADLAAHKIIETRLQ
ALTPDIPVFSEESGGIAYADRKDWPRFWLVDPLDGTKEFIKRNGEFTVNIALVEGDTPVL
GVVHVPVTAVTYMGGKGVGAFKEHNGERQAIECRARTTPVVMVASRSHGGEAVEKLEAFI
REEIGEVERASMGSSLKLCLVAEGSADIYPRLAPTSEWDTAAAHAVVAAAGGVVVNTDFA
PLQYNKEDILNPFFLVLGQSIEQWRFIAPALNG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgacggatttaaatgccctgctgggtccgcttggtgagattgcccgtgccgcg
ggacaggcgattcttgaggtttacgagcgcgatgatctgggtgtggaaactaaggatgac
aagtcgccgattaccgaggcagatttggcagcccacaaaattattgaaactcgattgcag
gcgctgacgccggatattccggttttctctgaagagtcagggggtattgcctatgcggac
cgtaaggactggccgcgtttctggctggtagatccgctggatggcaccaaggaattcatt
aagcgtaacggtgagttcaccgtcaatattgcgctggtggagggcgatactccggtgctg
ggggtggtgcacgtgccggtaacggctgtgacctatatgggcggaaagggcgtgggcgcc
tttaaagaacataacggtgagcgccaagccattgagtgccgtgcgcgcaccacgccggtg
gtgatggtggccagccgtagccatggtggtgaggctgtggaaaaactggaagcttttata
cgagaagagatcggggaagtggagcgcgcttccatgggctcctctcttaagctgtgtctg
gtggcggaaggcagtgcggatatttacccgcgccttgcgcctaccagcgagtgggatacg
gctgcggcccacgcggtggttgccgccgccgggggggtggtagtgaacaccgactttgcg
cccttgcagtacaacaaagaggacattcttaatccgttctttctggtgttggggcaaagt
attgaacaatggcgctttatcgctccggccttgaacggttga

DBGET integrated database retrieval system