KEGG   Alcanivorax borkumensis: ABO_0325Help
Entry
ABO_0325          CDS       T00380                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABO_0325 (tpiA)
   01230 Biosynthesis of amino acids
    ABO_0325 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABO_0325 (tpiA)
   00051 Fructose and mannose metabolism
    ABO_0325 (tpiA)
   00562 Inositol phosphate metabolism
    ABO_0325 (tpiA)
Enzymes [BR:abo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABO_0325 (tpiA)
Exosome [BR:abo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABO_0325 (tpiA)
  Exosomal proteins of bladder cancer cells
   ABO_0325 (tpiA)
  Exosomal proteins of melanoma cells
   ABO_0325 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356487..357230
Genome map
AA seq 247 aa AA seqDB search
MNRTPLVAGNWKMNGRKDLLTEMADALAGYAGAAEVVICPPFPYLAAARSAMPGAVGIGS
QNVSEQEDGAFTGEVSAPMLAEVGCGYVIIGHSERRALYGETDAQIASKFAHAQAAGLVP
ILCVGETLEERDSGNTDTIVCGQLRAVVDAVGVAAFANAIVAYEPVWAIGTGKTASPEQA
QAVHACLRQFLAKDDPDIAQSLRLLYGGSVKADNAALLFAQSDIDGGLIGGASLTADSFI
AICQAAE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaacccctctggttgcgggcaactggaaaatgaacgggcgcaaggacttgctt
accgaaatggcagacgctctggcgggttatgctggtgctgctgaggtggtcatctgtcca
ccttttccgtatttggctgcggccagatctgcgatgccgggggccgttggtatcggtagc
cagaacgtgagtgagcaagaggatggcgcttttaccggagaggtatctgcgccgatgcta
gccgaggtgggctgtggttacgtgattattgggcattccgagcgccgtgcgttatacggt
gaaacggatgcgcagattgccagcaagttcgcccacgctcaggctgcgggtctggtgccg
attctttgcgtgggtgaaacgctggaagagcgtgactctggcaatactgacaccatcgtc
tgtgggcaattacgcgcggttgtggatgcggttggcgttgcggcttttgctaatgcgata
gtggcctatgagccggtctgggcgatcggcactgggaagacggctagccccgagcaggct
caagctgttcacgcttgtttgcgtcaatttttagcgaaagacgacccggatatcgctcaa
tcgctgcggttgctttacggcggcagcgtaaaggcggataatgccgcccttctatttgcc
cagtcagacatcgatgggggtctgatcggtggggcatcgttaacagccgacagctttatt
gcgatctgtcaggcggcggaataa

DBGET integrated database retrieval system