KEGG   Alcanivorax borkumensis: ABO_0455Help
Entry
ABO_0455          CDS       T00380                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00330  Arginine and proline metabolism
abo00332  Carbapenem biosynthesis
abo01100  Metabolic pathways
abo01130  Biosynthesis of antibiotics
abo01230  Biosynthesis of amino acids
Module
abo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ABO_0455 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ABO_0455 (proB)
Enzymes [BR:abo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ABO_0455 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAL15903
UniProt: Q0VSE5
Position
494452..495582
Genome map
AA seq 376 aa AA seqDB search
MADRQRWVIKIGSALLTNDGKGLDCALMQTWVDRMVALRERGIEVVIVSSGAVAEGMTRL
GWSARPDSVHELQAAAAVGQMGLVQAWETRFQQHQLHTAQVLLTHDDLSDRKRYLNARST
LLTLLGFGVVPVVNENDTVVTDEIRFGDNDTLAALVANLVEADRLLILTDQEGLFDADPR
SNADANLIREARASDPAIVRVAGGGGLLGRGGMATKVRAGKLAARSGAITTIASGRSPEV
LIELADGQGPGTTLLPDTTPMNARKQWLAGHLQMRGRLVLDAGAVVRLREGGSSLLPVGV
VDVFGQFSRGEMVACEDERGERVGCGLVNYDAADARRICRKKSAEIAGVLGFMNEEELIH
RDNLVLMEAGSRVSGA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtggcggatcgccagcgttgggtaatcaagataggcagtgccttgctgaccaatgacggc
aagggcttggattgtgcgctcatgcaaacctgggtggatcgcatggtcgctctgcgtgag
cggggcattgaggtggtgatcgtctcatccggggcagtggccgaaggcatgacccgcctg
ggttggtccgctcgcccggattcagtgcatgagttgcaggctgccgctgcggtagggcag
atggggctggtgcaggcctgggagacccgttttcagcagcaccagctgcataccgcccag
gtgctacttacccatgatgacctttctgaccgtaagcgctatctcaatgcgcgctccacg
ctgctaaccttgctgggctttggtgtggtgccggtggtaaacgaaaacgataccgtggtt
accgatgaaattcgctttggcgataacgacacgttggcggcgttggtggccaatcttgta
gaggctgatcggctgttgatcctgacggatcaggaggggttgttcgatgcagacccgcgt
agcaatgctgatgctaatctgattcgcgaagcgcgtgcctcggacccggccattgtccgt
gtggctggcggcggcggtttgttggggcgcggaggtatggccaccaaggtacgagctgga
aagctggcggcccgttctggtgctattacaacgattgcgtcagggcgtagtccggaggtg
ttgattgagcttgctgacggacaggggccggggactacgctgttgccggataccacgcca
atgaatgcacgcaagcaatggttggcagggcatttgcagatgcgtgggcggttggtgctg
gatgctggggcggtggtgcgtttgcgtgaaggtggctctagcctgttgccggtaggagtg
gtggatgtgtttggccagttttcccgtggcgaaatggtggcctgtgaagatgagcgtggc
gagcgggttggctgtggcctggtgaattatgatgcggcagatgcgcgccggatttgtcgt
aagaaaagtgctgaaatcgccggtgtgctgggtttcatgaacgaggaagagctgatccac
cgggataacctggtgttgatggaggccgggagccgggtttcgggcgcttga

DBGET integrated database retrieval system