KEGG   Alcanivorax borkumensis: ABO_0494Help
Entry
ABO_0494          CDS       T00380                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00230  Purine metabolism
abo00240  Pyrimidine metabolism
abo01100  Metabolic pathways
abo03030  DNA replication
abo03430  Mismatch repair
abo03440  Homologous recombination
Module
abo_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABO_0494 (holC)
   00240 Pyrimidine metabolism
    ABO_0494 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ABO_0494 (holC)
   03430 Mismatch repair
    ABO_0494 (holC)
   03440 Homologous recombination
    ABO_0494 (holC)
Enzymes [BR:abo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ABO_0494 (holC)
DNA replication proteins [BR:abo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ABO_0494 (holC)
DNA repair and recombination proteins [BR:abo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     ABO_0494 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi adh_short_C2
Motif
Other DBs
NCBI-ProteinID: CAL15942
UniProt: Q0VSA6
Position
complement(543607..544053)
Genome map
AA seq 148 aa AA seqDB search
MASAARLLPMTEVTFYLSSKVGEGVRQALAWRIADKALKQGRQVYVHCQNEAHARQLDAQ
FWQSPPTGFLPHALSSEGQAPVLLGFGDDPGHQHDVLINLSDGVPDFSSRFQRVAEMISG
DEAERQQGRERFRFYRDRGFPVTTHELG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ttggcgtcagccgctaggcttttacctatgactgaagtcactttctatctcagcagtaaa
gtcggggagggcgttcgccaggctctggcttggcggattgccgataaagcgctgaaacag
ggccggcaagtctatgtgcattgccaaaatgaggcccatgcacggcagctggacgcgcaa
ttctggcaatctcccccaacaggcttcttgccccacgcactaagcagtgaaggtcaggct
ccggtattactcggattcggtgacgacccaggccatcagcacgatgtactgatcaacctg
agcgatggagtgcccgacttttcctcccgctttcagcgggtggccgaaatgatcagcggc
gatgaagccgaacgacaacagggccgggaacgttttcgtttctaccgggaccgaggcttc
cccgtcaccacccatgaacttggctga

DBGET integrated database retrieval system