KEGG   Alcanivorax borkumensis: ABO_0562Help
Entry
ABO_0562          CDS       T00380                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
abo  Alcanivorax borkumensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABO_0562
  Amino acid metabolism
   00340 Histidine metabolism
    ABO_0562
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ABO_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
619215..620516
Genome map
AA seq 433 aa AA seqDB search
METTWLNAQDADFDAKLAALTAWSEERDEEVAHRVRGILKGVAQRGDVALVEYTNRFDRR
DVSAMDELVVDQAQLQAALARIPAEQREALEAAADRVRRYHEKQKQDSWHYREADGTLLG
QQVTPLDRAGIYVPGGKAAYPSSVLMNALPAKVAGVGEIIMVSPAPEGIINDMVLAAAAI
AGVDKLFTLGGGQAVAALAYGTETVPAVDKIVGPGNIYVAEAKRQVFGKVGIDMIAGPSE
ILVVCDGKTNPDWIAMDLFSQAEHDEEAQAILVSPDADFLKQVAQSMETLAATLERETII
RTSMKHRGALIQVKDLDQAIEIANRIASEHLELSIDDAEQWAKKVRHAGAIFLGRHTPEA
LGDYCAGPNHVLPTSATARFSSPLGVYDFQKRSSLIGCSPEGASSLAKIASPLARGESLT
AHARSAEYRIKKR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccacctggcttaacgcccaagatgcggatttcgatgccaagctcgccgcgcta
accgcctggtcggaagagcgtgacgaagaggtggcgcatcgtgtgcgcggcatcctcaag
ggtgtggcccagcgtggcgacgtggcactggtggagtacaccaaccgctttgaccgtcgt
gatgtgtcggccatggatgagctggtagtggatcaggctcagttgcaggccgcgctggcg
cgtattcccgctgaacaacgcgaagccctggaggcggccgctgatcgtgtgcgtcgctac
catgaaaagcagaaacaggattcctggcactaccgggaagcggacggcaccttgctgggc
cagcaggtgacgcctttggatcgggccggtatttatgtgcccggcggtaaagccgcgtac
cccagctcagtattaatgaatgcgctaccggcaaaggtggcgggtgtcggcgagatcata
atggtatcgcctgccccagagggcatcatcaatgacatggtgctggcggcggcggctatt
gcgggtgtcgacaagctctttactctgggcggcgggcaagcggtggccgctttggcctac
ggtacagagacggtgccggcggtggataaaattgtcggccccggcaatatctatgtggcc
gaagccaaacggcaggtgtttggcaaagtaggcatcgacatgattgccggcccttcggaa
attttggtggtctgtgacggcaagaccaacccggactggattgccatggatctgttttct
caggctgagcatgatgaggaagctcaggccattttggtgtcaccggacgccgattttttg
aagcaggttgcgcagtccatggaaaccttggccgcgactctggagcgggaaaccattatt
cgcacgtccatgaagcaccggggggcgttgattcaggtgaaggatctggatcaggccatc
gaaatcgccaaccgcattgcttctgagcatctggaattatccattgatgacgcggagcaa
tgggcgaaaaaagttcgccatgccggtgcgatttttctgggtcgccacactcccgaagcg
ttgggtgattactgcgccgggccgaaccacgtgctgcctacgagtgccaccgcccgcttt
tcttcgccattgggtgtgtacgattttcagaaacgcagttcgctgattggctgctccccg
gaaggggctagcagtcttgcaaaaattgcctctccgcttgcccgtggcgaaagcctcacg
gcccatgcccgcagtgcggaatatagaatcaagaaacgctaa

DBGET integrated database retrieval system