KEGG   Alcanivorax borkumensis: ABO_0804Help
Entry
ABO_0804          CDS       T00380                                 

Gene name
dsbC
Definition
protein disulfide-isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abo  Alcanivorax borkumensis
Brite
Enzymes [BR:abo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABO_0804 (dsbC)
Secretion system [BR:abo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABO_0804 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
896231..896974
Genome map
AA seq 247 aa AA seqDB search
MKKGLLFVLLGLMTACGASSEGNKGNAEIDGDQAKAAFENAFDGVEVSDVRAAPMAGMLE
LEVNGGETVYMSENGRFVMVGKLLELKDGEVINPAEQRLEKVRADGIKTLNKDDMISYVA
PEETAEVYVFTDITCGYCRKLHRHIEEYMDSGVTVHYLAFPRGGPTTKAAAAMRHIWCAE
DRLQALTDAKLNEKVSDAELGECAKPVDEQYPLGLKFGVRGTPAIYTSEGKQLGGYLPPK
DLLKRLN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttgctgtttgtattattggggctgatgaccgcctgtggggccagttct
gaaggtaataaagggaacgccgaaatcgatggtgatcaagccaaagcggcgttcgagaac
gcttttgacggggttgaagtcagtgatgtgcgcgctgcccccatggcgggcatgcttgag
cttgaagtgaacggtggtgaaaccgtttatatgagtgagaatggccgctttgtgatggtc
ggtaagttgctggagctaaaagacggggaggtgatcaacccggccgagcagcgactagaa
aaagttcgcgccgacggcatcaagacgttaaacaaggacgacatgatctcttacgtggcg
cctgaagagacagcagaagtgtatgtgttcactgatattacctgcggatattgccgtaaa
ttgcaccgccatattgaggaatacatggactcgggcgtgactgtccattacctggccttc
cctcgtggtggccctaccaccaaggcagcagcggccatgcgccatatctggtgcgcagaa
gatcgccttcaagcactgaccgatgccaagctcaacgaaaaggttagcgatgccgagctg
ggtgagtgtgccaagccagtggatgagcaatacccattgggcttgaaatttggggtgcgt
ggtacaccggcaatctatacctctgagggcaagcaactgggggggtatttaccaccgaaa
gatttgctcaagcgactgaactga

DBGET integrated database retrieval system