KEGG   Alcanivorax borkumensis: ABO_0807Help
Entry
ABO_0807          CDS       T00380                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABO_0807 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABO_0807 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ABO_0807 (thrC)
Enzymes [BR:abo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ABO_0807 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899765..900847
Genome map
AA seq 360 aa AA seqDB search
MPFRDRYTGLINRYRDHLPVNDDTPIISLGEGNTPLIRLKNIPKLLGKDVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSNAIICASTGNTSAAAAAYAARAGITAFVLIPEGKIAMG
KLAQAMMYGAVIMQIRGNFDQGMELVKQVADKAPVTIVNSVNPYRLQGQKSAAFEIVEEL
GRAPDYHCLPVGNAGNITAHWMGYSEYHKSGIVNAAPKMVGYQAEGSAPFMRGERVEDPE
TVATAIRIGNPQSWDKAWKLQEESKGWFDELSDHEILTAQKLLAEKEGIFCEPASAASIG
GAMRDIQSGKIPEGSTIVCTLTGNGLKDPDTAIAQCQDSRMVTIDADLDAVKGAILSNMS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcgtgaccgttacaccggcttgatcaaccgctaccgtgaccacctgccggtg
aatgatgacacgccgatcatcagcttgggtgaggggaataccccgctaattcgcctgaag
aatattcccaagttgttgggcaaggacgtggatatctacgtcaaatacgaaggtcttaat
cccacgggatcttttaaggaccgtggtatgaccatggcggtgaccaaggccgtggaagag
ggcagtaatgccatcatctgtgcttccaccgggaacacttctgcagccgctgcagcctat
gcagctcgtgcgggcattactgctttcgtactgattccggaaggcaagattgccatgggc
aagctggctcaggcgatgatgtatggtgccgtgatcatgcagatccgtggcaatttcgat
cagggtatggagttggttaaacaggtggctgacaaggcgccggtgaccatcgtgaactcg
gtaaacccgtatcgtctgcaaggccagaagtctgctgccttcgaaattgtggaagaactg
gggcgcgcgccagactaccactgcctgcctgtgggcaatgcaggtaatattactgcacat
tggatgggctacagcgaataccacaaatcaggcatcgtaaatgcggcgccgaagatggtt
ggttatcaggctgaaggttctgcgccctttatgcgtggcgagcgggttgaggatccggaa
acggtagcaaccgctattcgtatcggtaacccgcagtcctgggacaaggcctggaagcta
caggaagagtctaaaggttggttcgacgagctgagtgatcacgagattttgacggcacag
aaattgctggcagaaaaagaaggcattttctgtgagcctgcttccgccgcgtcaatcggt
ggtgccatgcgagatattcaatctggcaagattccggaaggctctaccatcgtttgcacg
ttgacaggcaatggtttgaaagaccctgacacggccattgctcagtgtcaggacagtcgc
atggtgaccattgatgcggatctggatgcggtgaaaggcgcaattctgtcaaacatgtct
taa

DBGET integrated database retrieval system