KEGG   Alcanivorax borkumensis: ABO_0914Help
Entry
ABO_0914          CDS       T00380                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
abo  Alcanivorax borkumensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:abo00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:abo00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021922..1022473
Genome map
AA seq 183 aa AA seqDB search
MEVIETRIPEVKLIKPKVFGDERGFFMETWNARAFAEAGIDATFVQDNHSRSVKNTLRGL
HYQIKQPQGKLVRCTRGEVFDVAVDLRKSSPTFGQWVGEILSEENQNQLWVPPGFAHGFL
VMTETADFQYKCTDFYAPEHDRCIHWADSKIGIDWPFEPEARSPLVSQKDAAGARLLDAE
VYD
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgattgaaacccgtattccagaggtaaagctcatcaagccgaaagtgtttggc
gatgagcgtggcttcttcatggaaacctggaatgcacgagcctttgccgaagccggtatc
gacgccaccttcgtccaggacaaccatagccgctctgtcaaaaatacccttcgcggcctt
cattaccagatcaagcagccccaggggaaactggtgcgctgtacccgtggtgaggttttt
gatgtggcggtagatctgagaaaaagctcgcccacctttggtcagtgggtgggggaaata
ctatcggaagagaaccagaaccagctgtgggtgccgccggggtttgcccatggttttttg
gtgatgaccgaaacggctgattttcagtataaatgcactgatttctatgctcctgagcat
gaccggtgcatccactgggctgattcaaaaattgggattgactggccatttgaaccagaa
gcgcgatcgcccctcgtatcgcaaaaggatgcggcaggcgcacggctgctggatgcagag
gtatacgattga

DBGET integrated database retrieval system