KEGG   Alcanivorax borkumensis: ABO_0934Help
Entry
ABO_0934          CDS       T00380                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abo  Alcanivorax borkumensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABO_0934 (galU)
   00052 Galactose metabolism
    ABO_0934 (galU)
   00500 Starch and sucrose metabolism
    ABO_0934 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ABO_0934 (galU)
Enzymes [BR:abo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ABO_0934 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1045980..1046861
Genome map
AA seq 293 aa AA seqDB search
MVRKAVLPVAGFGSRMLPASKSIPKEMLPVVDRPAIEYVVKEAVRAGIKDIVLVSHSSKS
AIEDYFDTQFELEHQLEKKGKTALLDALQNILPADVNIISVRQHHALGLGHAVACAAPVI
GNEPFAVLLPDVLVDCQDIEEDLAVMVRRYHDTSAAQIMVEEVPAQRVDQYGIVALEGDA
PKAGDSAAMRAIVEKPPINEAPSRLSVVGRYVLPGEIMAILAETQPGAGNEIQLTDAIAT
LIKQSPVEAYSMRGQTFDCGNKAGYLRAIFHYAARHPDLGEHARAMMAEASQH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggttagaaaagcagtgttaccggtggcggggtttggttcgcgtatgttgccggcgtct
aagtcgataccgaaggaaatgttgcccgttgtggaccgaccggctattgagtacgtggta
aaggaggcggttcgagcagggatcaaagatattgtattggtatcccattcttccaagagc
gcgattgaagactattttgatacccaatttgagctagagcatcagcttgaaaagaaaggt
aaaacggctttgctggatgcgctgcagaatatccttccggcggatgtaaatattatttct
gtgcgtcaacatcacgccctggggctggggcatgcggttgcctgtgccgccccggtgata
ggcaatgagcctttcgcggtgttgctgcccgatgtgttggtggattgccaggatatagaa
gaggatctggcggttatggtccgccgttatcatgatacgtctgccgcccaaattatggtg
gaagaggttcccgcgcagagggttgatcaatacggaattgtggctttggagggggatgcc
cccaaagctggtgattctgctgccatgcgcgccattgtagaaaaaccgcctattaatgag
gctccgtctcggttatccgtcgtgggccgttatgtgctccccggtgaaattatggccatt
cttgctgagacacaacccggggcaggtaacgagattcagctcaccgatgcgattgcaaca
ttaattaagcaaagccctgtggaggcttattccatgcgtggccagaccttcgattgcggt
aacaaggcgggctatttgcgcgctatattccattatgctgcgcgacacccagatttgggc
gagcatgccagagccatgatggccgaagctagccagcactaa

DBGET integrated database retrieval system