KEGG   Alcanivorax borkumensis: ABO_0983Help
Entry
ABO_0983          CDS       T00380                                 

Gene name
pcaF
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abo  Alcanivorax borkumensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABO_0983 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    ABO_0983 (pcaF)
   00640 Propanoate metabolism
    ABO_0983 (pcaF)
   00650 Butanoate metabolism
    ABO_0983 (pcaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_0983 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    ABO_0983 (pcaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABO_0983 (pcaF)
   00310 Lysine degradation
    ABO_0983 (pcaF)
   00380 Tryptophan metabolism
    ABO_0983 (pcaF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABO_0983 (pcaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABO_0983 (pcaF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABO_0983 (pcaF)
Enzymes [BR:abo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABO_0983 (pcaF)
Exosome [BR:abo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABO_0983 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1107771..1108979
Genome map
AA seq 402 aa AA seqDB search
MLDAYIYDGLRTPFGRHGGVLASVRPDDLLAGVIRELVQRNGFAASLYEDVVIGNTNQAG
EDARNVARHAGLLAGLPQSVAGITVNRLCGSGLAATLDAARMVTVGEGELIIAGGTESMS
RAPYVMAKAEKAFSREMTVFDSTIGARFPNPKVLKQFGADTMPQTAQNVAHDLGISREDA
DAFAIQSQQRYEVAREQGFYQQEVLPVTVPQGGKATPLRVADDEHPRPGTCVDKLRQLPA
IVDGGIITAGNASGINDGAAAVIVGSRRAGVAAGIAPRARVLSGAVAGVAPRVMGLGPVD
ACNKALARAGLALAQMDVIEINEAFAAQVLGCCKQLGLAGDDERLNPNGGAIAVGHPLGA
SGARLVLTAMRQLERTRGRYALLSLCIGVGQGVAMVLERVDS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgcctatatctacgatggtctgcgtaccccttttggtcgccatggcggcgtt
ctggcatcggtacgcccggatgacctcttggccggagtgattcgcgaactggtacagcga
aatggctttgcggcttctctgtatgaagatgttgtcattggtaatactaatcaggcgggg
gaagatgcccgtaatgtggctcgtcatgccgggttattagctgggttgccgcagtccgtg
gcggggatcaccgtgaataggttatgtggcagcggcctcgccgcaacattggatgcggca
cgtatggtgacggtgggcgagggcgagttgatcattgccggtggtacggaatcgatgagc
cgtgccccttatgtaatggccaaagcagaaaaagcgtttagccgggagatgacagttttc
gatagcactatcggcgcccgcttccctaacccgaaagtgctcaagcagtttggtgccgat
actatgccgcagacggcacagaatgtagcgcacgacctgggtattagccgtgaagatgcg
gatgcttttgctatacagtctcaacaacgctatgaggtcgcccgtgagcaagggttttat
cagcaggaagtgttaccggttacggtgccccaggggggcaaggcgacaccactgcgtgtg
gctgacgacgaacatccccgccccggaacctgcgttgataagttgcgacaactgcctgct
attgtcgatgggggcattattactgcgggtaatgcgtctgggataaatgacggggcggcg
gcagtgattgtgggttcgcgtagggctggtgtggcggcgggtattgctccccgtgctcga
gttctgtctggtgcggttgccggagtggcgcctcgcgttatgggcctaggcccggtggat
gcgtgcaacaaggcattggcccgggcgggcctggcgttagctcagatggatgtgattgaa
attaatgaggcgtttgccgcccaagtgctgggctgctgtaagcagttgggcttggctggg
gatgatgagcgcctgaacccaaatggtggcgctattgctgtcggccatccgttaggtgcg
tccggtgcgcgtttggtcttgactgccatgcgtcagttggagcgaacccgcggtcgttat
gcacttcttagtttgtgcattggcgtaggtcagggcgttgccatggtgctggagagggta
gattcatga

DBGET integrated database retrieval system