KEGG   Alcanivorax borkumensis: ABO_1018Help
Entry
ABO_1018          CDS       T00380                                 

Gene name
nagZ
Definition
Beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
abo  Alcanivorax borkumensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ABO_1018 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ABO_1018 (nagZ)
Enzymes [BR:abo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ABO_1018 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155851..1156888
Genome map
AA seq 345 aa AA seqDB search
MSSVYKVAMSASASPLLMLDLEGLEVSASEKDMLAHPGAGGLILFARNYVDRQQLAELVQ
QVRAVRPEMLIAVDQEGGRVQRFRDGFVRLPPMAALGQRYDQAPAQAVGEATLLGELMAS
ELTELDIDISFAPVLDLDYGNSSVIGDRSFHGDADAMIALAGAFIDGMSAAGMAATGKHF
PGHGHVGADSHLELPIDPRPLSELEAADMRPFMALAPKLDGIMPAHVIYSAVEQQTAGFS
RYWLQTQLRERLGFRGVIFSDDLSMAGAHGVGGYPQRAQAALEAGCDMVLACNCCEGAEQ
VLDFLGTQNFSGQVPAAGLRARPRLPMDAQRRAVAADLAAALREH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgtctataaggttgccatgtctgcatccgcgtccccgctattaatgcttgat
ctggaaggtcttgaggtcagtgcctcggaaaaagacatgctggcacaccccggtgccggt
ggtttgattctgtttgcccgcaattatgtggatcgccaacaactggcggaattggtgcag
caggttcgtgctgtgcgcccggagatgctgattgccgtggaccaggaaggcgggcgcgta
cagcgctttcgcgacggctttgtgcgtttgccgcctatggcggccctggggcagcgttat
gatcaggctccggctcaagccgtgggggaagcgaccttgctaggggagctgatggcctcg
gagctaaccgaactggatatcgatatcagctttgcgccggtgttggatctggattacggc
aacagctcggtgatcggtgatcgcagcttccatggcgatgccgatgccatgattgctctg
gctggcgcctttatcgacggcatgagcgccgctggcatggcggccacgggcaagcacttt
cccggccatggccatgtgggcgcggattctcatctggaattaccaatagatccacgccct
ctgtctgaattggaggcggcggacatgcgccctttcatggctttggcgccaaaactggac
ggcatcatgccggcccatgtgatctatagcgccgtggaacaacagaccgccggtttctcc
cgttattggttgcagacgcagctgcgtgagcgactgggcttccgtggtgtaattttctct
gatgatctgtccatggctggagcccacggtgtgggcggatacccccagcgcgcgcaagca
gcgttggaggcgggctgcgacatggtattggcttgcaattgctgcgaaggggcggagcaa
gttctggattttctgggcacacagaacttttcagggcaggtaccggcggcagggctgcgt
gcccgcccgcgcctgcctatggacgcacagcgcagggcggtggccgctgatttggctgca
gcattacgtgaacactga

DBGET integrated database retrieval system