KEGG   Alcanivorax borkumensis: ABO_1231Help
Entry
ABO_1231          CDS       T00380                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ABO_1231 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABO_1231 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_1231 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABO_1231 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABO_1231 (adhA)
   00626 Naphthalene degradation
    ABO_1231 (adhA)
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABO_1231 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402134..1403126
Genome map
AA seq 330 aa AA seqDB search
MTFKALQTRETEAGYSNVLVDRELSELGEGGVLVRVQWSSLNYKDALSATGNKGVTRQFP
HTPGIDAVGVVEEASDGPFSAGDAVICTGYDLGMNTDGGYAEYIRVPAEWLVPLPEGLAP
RDAMLLGTAGLTAALSVESLLDTGVNPDQGPVLVTGATGGVGSISVAILAKLGFEVVAVS
GKADAHEWLTELGASRIIDRNDFLESAAKPMAKEQWSGAVDCVGGEMLAAALKGLKYGGS
ATCCGLAGSPKLEMTVFPFILRGVNLLGVDSVELPCEIKQQMWQLLADEWMPKDLSLLEA
AQTELSGVTDWVDRILAGGVRGRVVVKLPE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacatttaaggcattacagacccgcgaaaccgaggccggttacagtaacgtgctggtt
gaccgcgagctaagtgagctgggcgaaggcggtgtattggtacgggtgcaatggtcgtct
ctgaattacaaggatgcactgtcagccaccggcaacaaaggcgttacccgccaattccct
cataccccaggcattgatgcggttggcgtggttgaagaggcgagtgatgggccttttagt
gcgggcgatgcggtgatttgcacaggctatgatctggggatgaacacggatggcggttat
gcagaatatatccgcgtaccggctgagtggctagtgccgctaccagaaggccttgcgcct
cgcgatgcaatgttgcttggtacggcagggctaaccgcagccttgagtgttgaatcgttg
ctggatacgggcgttaacccggatcaggggcccgtgctggtgactggcgcgactggtggc
gtgggcagcattagtgttgcgatactggctaagttaggttttgaggtggtggccgttagt
ggcaaagcagacgcccacgaatggctcactgagcttggtgcatcacgcatcattgatcgc
aatgattttctggaaagtgccgccaagcccatggccaaagagcagtggtcgggcgctgtg
gattgcgtggggggtgaaatgctggccgctgctctgaagggtctaaagtacggaggtagt
gccacttgctgtgggttagccggttctcccaagcttgagatgacggtttttccattcatt
ttgcgcggagtaaatctgttaggggtagatagcgttgaattaccctgtgaaattaagcag
caaatgtggcagttactggcggatgaatggatgccgaaagacctttcactgctggaagcg
gcgcaaacggagctttctggggtgaccgattgggtggatcgcattctggctggaggagtt
cgcgggcgggtcgtggttaagctgcctgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system