KEGG   Alcanivorax borkumensis: ABO_1259Help
Entry
ABO_1259          CDS       T00380                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
abo  Alcanivorax borkumensis
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    ABO_1259
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     ABO_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1433447..1435015
Genome map
AA seq 522 aa AA seqDB search
MENVDVLVIGSGFGGAVMACRLAEKGRKVVVLERGRRWLPSDYPSVSQKNWFWDEAEPEK
QNGWVDFRNFGDMSIAMGAGVGGGSLIYANVSIEAKPEAFDHGWPQAINYSTLKPYYDIT
GVMLNVQTLPASQWTPRTHLMKEAADAVGAGDRFTVLPQAITFDPDWRAENDDCFDYRHS
KMWVNAQGKQQGTCTHCGNCDLGCPVKAKNTLDLNYLAAAESAGAQIRPLHHVRTIRPLA
SGGFEVRAMDLDARGWRVFKANKVIVAAGSLGSTELLLRCRDQYKTLPKLSRKLGHNWSS
NGDFATAAFYDDRQISPTRGPTITSAIDYLDGSDNGARYFVEDGGLPDILGSWLERLGKQ
PRFSSTRLGAAMLKYGDSSNPFGKMMPWFGQAMDEPGGTFSLARRWYWPWKREHLKLRWD
YRKAEKAVQGLADRHLALTAATGGSPMAPVTWSWFKNLVTPHPLGGCNMADSVEQGVVNH
AGEVFNYPDLYVIDGAMVPRALGLNPSRTIAALAEYCAAQMD
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtggatgtgctggtcatcggcagtggtttcgggggcgctgtaatggcatgt
cggttagcagagaagggccgtaaggttgtcgtgctggagcggggacgacgctggctgcct
agtgattacccctctgtttcacagaaaaactggttctgggatgaagcggaaccggaaaaa
caaaatggatgggtcgatttccgcaatttcggcgatatgagcattgccatgggcgcaggc
gttggcggtgggtcgttgatctatgccaatgtaagcattgaggctaaaccagaagcgttc
gaccacggttggccgcaagcgattaattattccaccttgaagccttactatgacatcact
ggagtgatgctcaatgttcagaccttgcccgccagccagtggacgccccgaacccatttg
atgaaagaggcggcagatgcggtaggtgcgggggatcgattcacggtgctgccccaggca
attacattcgatccggattggcgagcggaaaacgacgactgtttcgattatcgccacagt
aagatgtgggtaaatgcccagggaaagcagcagggtacttgcacccattgtggcaattgt
gatttggggtgtccggttaaggccaaaaacaccttggatcttaattatctggcagcggca
gaaagcgctggtgcgcagatccgtccattgcatcacgtgcgtaccattcgcccgctggcg
tcaggaggttttgaggtgcgcgccatggatctggacgcgcgtggctggcgagtctttaag
gccaataaagtgattgtggccgctggctccctgggctccactgaactgttgctgcgttgt
cgagatcaatacaaaacgctaccaaagttaagccgtaaactggggcataactggagcagt
aacggcgactttgccacggcggcgttctacgatgatcgacagatttcacccacccggggg
ccaaccatcaccagtgctatcgattacttggatggatctgataacggtgcccgttatttt
gtagaagacggcggtcttccggatattcttggaagctggctggagcgattgggcaaacag
cctcgctttagtagcacacggttaggagccgcgatgctcaagtatggcgatagcagtaac
ccctttgggaaaatgatgccctggtttggtcaggccatggatgaaccgggcggtactttt
tccttggcgcggcgttggtattggccctggaagcgtgagcacctgaaactgcgttgggac
taccgcaaggcagaaaaagccgtgcaaggcctggccgatcgccatttagcgctaacggcg
gccactggcggtagcccgatggctccagtcacctggagctggttcaagaatttggttacc
ccgcaccctctgggcggctgcaatatggcggactctgtggaacagggggtggtgaatcat
gccggggaagtgttcaattaccctgatctttatgtgatagatggcgccatggtgccgcgg
gcactgggcttaaacccgtcccggaccatcgcagcactggcggaatattgtgcggctcag
atggactaa

DBGET integrated database retrieval system