KEGG   Alcanivorax borkumensis: ABO_1267Help
Entry
ABO_1267          CDS       T00380                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
abo  Alcanivorax borkumensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABO_1267 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABO_1267 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ABO_1267 (glcB)
Enzymes [BR:abo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ABO_1267 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1442053..1444212
Genome map
AA seq 719 aa AA seqDB search
MTDRIQKGGLEIAAELHDLVVNEIAPGTGVDPEHFWAELESILNDLAPKNKALLAKRDDL
QKQIDAWHKARVGQAIDMAEYKQFLTEIGYLLPEGEDFNITTENVDAEIATIAGPQLVVP
VKNARFALNAANARWGSLYDALYGTDVISDEGGAEKGGAYNPKRGAKVIAWARDFLDNYF
PLASGSHKDSTGYAIEDGKLVVSLGEEKTGLKDASQLQGFLGDAAAPTGVLVKHNNLHAE
IQFDASHPIGADDAANMKDVLLESAITTIQDCEDSVAAVDAEDKVEVYRNWAGLMKGDLE
ESFQKGGKTMTRSMNADREYTALDGSSLTLHGRSLLLVRNVGHLMTNPAILHNGEETPEG
IMDGMVTVLAAMHDLKKINKLSNSRTGSVYIVKPKMHGPEEVAFAVELFERIEKALGLAA
NTLKIGIMDEERRTTVNLKECIRQAKDRVIFINTGFLDRTGDEMHTSMEAGPMAPKGEMK
TLPWISAYEDWNVDIGLECGLKGHAQIGKGMWAMPDEMAQMMANKAGHPKAGANCAWVPS
PTAATLHVTHYHEINVAEVQEKLAGRARASLDDILTIPLLTRELSAEEIQQELDNNAQGM
LGYVVRWIDSGVGCSKVPDINDVGLMEDRATLRISSQHVANWLHHGICSKEQVLETMKRM
AEVVDRQNANDPDYVPMAKDFDGSVAFQAACELVFEGCAQPSGYTEPVLHRRRRELKAK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgtattcagaagggtggccttgaaatcgccgccgaactccatgatctggta
gtcaatgagattgcgccgggtaccggcgtcgacccggagcacttctgggccgagctggaa
agcattcttaatgacctagcccccaaaaacaaagcgctactggccaaacgtgacgacctg
cagaagcagatcgacgcttggcacaaggcccgcgtggggcaggccatcgacatggctgag
tacaagcagtttctaaccgaaattggttacctgctacccgagggcgaagactttaacatc
accaccgaaaacgtggatgcggaaattgccaccattgctggcccgcagctggttgtgccg
gtgaagaatgcacgctttgccttgaatgcggcgaatgctcggtggggtagcttatacgat
gccctgtacggcaccgatgtgatttccgacgaggggggggccgagaaaggtggcgcttac
aacccgaagcgcggcgccaaggtgattgcctgggcccgtgactttttggataattacttc
ccgctggccagtggctcccacaaagacagcactggctacgccattgaagacggcaagctg
gttgtgtctctgggcgaagagaagaccggccttaaagacgcatctcagcttcagggtttc
ctgggcgatgccgcagcccccaccggggtgctggtgaagcacaacaatctgcatgcggaa
attcagttcgacgccagccacccgattggtgctgacgacgcggccaacatgaaagatgtg
ctgctagagtctgccatcaccaccatccaggattgcgaagactctgtcgccgctgtggat
gcggaagacaaagttgaggtttaccgcaactgggctggcctgatgaaaggcgatttggaa
gagagcttccagaaaggcggcaagacgatgacccgttccatgaatgcggatcgtgagtac
accgcgctggacggttcctccctgaccctgcacggtcgttcgttgctgctggtgcgtaac
gtgggtcacctgatgaccaacccggccattctgcacaacggtgaagaaacgcctgaaggg
attatggatggcatggtcactgtactggccgccatgcacgacctgaagaaaatcaacaag
ctgagtaacagccgcaccggttcggtctacattgtgaagccgaaaatgcacggcccggaa
gaagtggcctttgcggttgagctatttgagcgcatagaaaaagcattaggtttggccgct
aacacattgaaaattggcattatggacgaagagcgccgcactactgtgaacctgaaggag
tgtatccgtcaggccaaggatcgcgttatcttcatcaacacaggcttcctcgatcgcacc
ggtgacgaaatgcacacctccatggaagcgggccccatggcacctaaaggtgagatgaaa
accctgccgtggattagcgcctacgaagactggaacgtggacattggcctggaatgcggc
ctgaaaggtcacgcccagatcggtaaaggcatgtgggccatgcccgatgaaatggcacag
atgatggccaacaaggcgggtcacccgaaagcgggcgccaactgtgcctgggtgccgtca
cccactgccgccaccctgcacgtaacccactaccatgagatcaacgtggccgaggttcag
gaaaagctggccggccgtgcccgcgcttctctggacgacatcctcaccattccactactg
acccgtgagctgagcgctgaagaaatccagcaggagctggataacaacgcgcaaggcatg
ctcggctacgtggttcgctggatcgatagcggtgtgggctgctccaaggtacccgacatc
aatgatgtgggcctcatggaagaccgtgcaaccctgcggatttccagccagcatgtcgct
aactggctgcaccacggtatctgcagtaaagaacaggtactggaaaccatgaagcggatg
gcggaagtggtagatcgtcagaatgccaatgatcccgactatgtgcccatggccaaggac
ttcgacggctccgttgccttccaggcagcctgtgagttggtatttgaaggctgcgctcaa
ccaagcggctacaccgaaccggttctgcaccgtcgtcgccgtgaactgaaagcgaagtaa

DBGET integrated database retrieval system