KEGG   Alcanivorax borkumensis: ABO_1310Help
Entry
ABO_1310          CDS       T00380                                 

Gene name
cheB
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
abo  Alcanivorax borkumensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:abo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:abo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1487530..1488111
Genome map
AA seq 193 aa AA seqDB search
MNTCIGGVKAIVMGASWGGLNAYIHILSVLPADFPLPILMVQHQQASADNRMPWLLARYC
ALPVVTPEDKEPIIGGHVYVAPPGYHMLVEDDQTLAFSNGRPVLFSRPAIDELFFSAGVV
YGRHLIGVILTGANEDGAAGMKYIHSRGGFTIAQSPVSSEAPTMPEAAITTGAISRVLDL
EAIGPFLAKQAMG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacttgcatagggggagtaaaggcaattgttatgggcgcgtcttggggcgggctt
aatgcctatattcacattctgtctgtgttgcccgcggattttcctttgccaatcctgatg
gtacagcaccagcaggctagcgcggataaccgtatgccgtggttactggctcgttactgt
gctttaccggtggttacaccggaagataaagagccgattataggggggcatgtttatgtg
gccccgccgggttaccatatgttggtggaagacgatcagacactggctttctctaatgga
aggcctgtactcttttcccggccggcaatagacgaattgtttttttctgctggcgttgtt
tatggccgtcatctgataggcgtgattctcacaggggccaatgaagacggcgcagcaggc
atgaagtatatacacagtagaggcggattcaccatcgcccagtcaccggtgagctcggaa
gcacccacaatgcctgaagcggcaataacaacaggtgcgatttccagggtactcgatctt
gaggcaatcgggccctttttggctaaacaggctatggggtag

DBGET integrated database retrieval system