KEGG   Alcanivorax borkumensis: ABO_1400Help
Entry
ABO_1400          CDS       T00380                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abo  Alcanivorax borkumensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABO_1400 (tesA)
Enzymes [BR:abo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ABO_1400 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ABO_1400 (tesA)
Lipid biosynthesis proteins [BR:abo01004]
 Fatty acid synthase
  Component type
   ABO_1400 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1594763..1595431)
Genome map
AA seq 222 aa AA seqDB search
MWASKTGDVVFMARYLLLVQLLCLAASVHANGVLILGDSISAAYGIEKSSGWVALMDRQL
KERCPDFPVINASVSGETTAGGKARLPTLLARHKPDLVVVELGGNDGLRGLSPMVMASNL
KQMISLSRQAEADVVLLGMRIPPNYGQQYTALFERQYRDVAQSTSVPWVPFFLEGVIEQG
WMQGDGIHPTIEAQPLLLETALSVIEPQLPSRCRSHISTETE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgtgggcaagcaaaacgggagacgttgtattcatggcaagatatcttctgctggttcag
ttgttgtgcctggcggcatccgttcatgccaatggcgtgctgatactgggcgatagtatc
agtgctgcctacgggattgaaaaatcatctggctgggttgcccttatggaccgacagctg
aaggaaaggtgcccggattttccagtgattaatgcatcggtaagcggggaaactactgct
ggcggtaaagcacggttgccgacgcttctggctcgccacaagccggatctggtggtggtg
gaactaggaggtaacgatggtctgcgtggcctgtctcccatggtcatggccagcaacctt
aagcagatgatctcactctcgcggcaggcagaggccgacgtggtgttgttgggcatgcgc
atcccccccaactatgggcagcaatatacggccttgtttgaacggcaataccgtgacgtt
gcgcagtccacctcggtaccttgggtacctttttttctggagggtgtgatcgagcaggga
tggatgcagggcgatggcattcacccaacgattgaagcacagccattactattggaaacc
gcgctgtcggttattgagccgcaattaccgtcacggtgccgtagccatatcagtaccgaa
accgagtga

DBGET integrated database retrieval system