KEGG   Alcanivorax borkumensis: ABO_1460Help
Entry
ABO_1460          CDS       T00380                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABO_1460 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABO_1460 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABO_1460 (trpA)
Enzymes [BR:abo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABO_1460 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1665745..1666548)
Genome map
AA seq 267 aa AA seqDB search
MRRIERCFQRLDGENRKALIPFVTAGDPVKDVTVPLMHAMVDAGADIIELGVPFSDPMAD
GPVIQLACERALQHNTSTRDVLAMVKIFRETNTQTPVVLMGYLNPVEVMGYESFAKAAED
AGVDGVLLVDLPPEEALEVRPVMDAHGLDMIFLVAPTTSDTRIKLIGEAGSGYLYYVSLK
GVTGSATLNVEEVASRVETIRNLAQLPIGVGFGIKDAESAQAVSRVADGVVVGSALVNQI
AENKNTPDAINDAVGGILSAMRKAMDQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtattgaacgttgcttccagcgcctagacggtgagaaccgtaaagcgctgatt
ccttttgtaacggcgggtgatccggttaaggatgtaaccgtgccgttgatgcacgccatg
gtggatgccggggcagatattattgagctgggggtgccgttttccgatcccatggccgat
gggccggtaatccagttggcctgtgagcgggctttgcagcacaacacgtccacccgtgat
gtactggccatggtgaagatcttccgtgaaaccaacacgcagacccctgtggtgctgatg
gggtatttgaacccggttgaagtaatgggctatgaatctttcgctaaggccgcagaagat
gcgggtgtggatggggtgttgttggtggatttgccgccagaagaggctttggaagtaagg
ccggttatggatgcccatggcctagacatgatctttctggtggcaccgactacctctgat
actcgcataaagctgattggcgaagccggttccggctatctgtattatgtctctttgaag
ggtgttactggctctgcaaccctgaatgtggaagaggtggccagccgcgttgaaacaatt
cgcaaccttgcccaattgcccattggggtcggctttggtatcaaagacgctgaatctgcg
caggcggtgagccgggtagccgatggtgtggtcgttggtagtgctctggttaatcaaatt
gctgaaaataagaatactcccgacgcgattaatgacgcggttgggggtattctcagcgct
atgcgtaaagccatggatcaataa

DBGET integrated database retrieval system