KEGG   Alcanivorax borkumensis: ABO_1461Help
Entry
ABO_1461          CDS       T00380                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABO_1461 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABO_1461 (trpB)
Enzymes [BR:abo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABO_1461 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1666657..1667868)
Genome map
AA seq 403 aa AA seqDB search
MSERPDFSAFPDARGHFGRFGGSFVSETLMGALDELTAMYERLKDDPQFRADFDYDLAHY
VGRPSPLYLAERWSKQLGGAKIWLKREDLNHTGAHKVNNTIGQALLAKHMGKPRVIAETG
AGQHGVATATVAARLGLECQVYMGAEDVERQKLNVYRMKLLGAEVIPVTSGSRTLKDAMN
EAMRDWVTNVDNTFYIIGTVAGPHPYPQLVRDFQCIIGREAREQSLKQAGQLPDALVACV
GGGSNAIGLFHPFLNDEDVLMYGVEAAGDGIETGRHAAPLNAGRPGVLHGNRTYLMEDDN
GQIIETHSVSAGLDYPGVGPEHSWLKDIGRVNYVAADDQEALSAFRELTQVEGIMPALES
AHALAYARKLAPTMSADQNIVVNLSGRGDKDILTVAAIDGIDF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaacgccctgatttttctgcttttcctgatgcgcgtggccactttggccggttt
ggtggcagctttgtttcggagaccctgatgggggcactggacgaactgacggccatgtat
gagcgtcttaaggacgatccgcagttccgcgcggatttcgactatgatttggcccattat
gtgggccgcccatctccgctttatctggcggagcgatggtcgaagcagctcggtggggcg
aagatctggctcaagcgcgaagatctcaatcacaccggcgctcacaaggtgaataacacc
attggccaagctctgctagccaagcatatgggcaagccccgtgtgattgcagaaaccggt
gcgggccagcacggtgtggccacggcgacagtggccgcacggttaggtctagaatgccaa
gtgtatatgggcgcggaagatgtggagcgtcagaaactcaacgtctatcgaatgaagttg
ctgggcgcggaagtgattccggttacctcagggtctcgtaccttaaaagacgctatgaat
gaggccatgcgtgactgggtgaccaacgttgacaacactttctacattatcggcaccgtg
gccggtcctcacccttatccgcagctggtgcgcgatttccagtgcattattgggcgtgag
gcccgtgaacaaagtctgaaacaggcggggcagcttcccgatgcgctagtagcctgtgtc
ggcggtggctccaatgctattggtctgttccatcccttcctcaacgatgaggatgtgctc
atgtatggtgtagaagcggcgggggatggtattgaaaccggtcgtcatgctgcgccttta
aacgcgggccgcccgggtgttttgcacggcaatcgtacttacctgatggaagacgataac
ggccagatcatcgaaacacattccgtgtcggcgggtttggattacccgggtgtcgggcct
gaacattcctggcttaaggatattggccgggttaattatgtggctgctgacgaccaagaa
gccctgtcggcgttccgcgaattgactcaggtagaaggcattatgccagctttagagtct
gcccatgcgctggcctacgctcgcaagctggcccccaccatgtctgcggatcagaacatt
gtggtgaatctatctggtcggggtgacaaggatatcctgaccgtggccgccattgatgga
atcgatttttaa

DBGET integrated database retrieval system