KEGG   Alcanivorax borkumensis: ABO_1479Help
Entry
ABO_1479          CDS       T00380                                 

Definition
short chain dehydrogenase/reductase family oxidoreductase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
abo  Alcanivorax borkumensis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ABO_1479
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ABO_1479
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ABO_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1687637..1688461
Genome map
AA seq 274 aa AA seqDB search
MKQSPTLLITRGCTPLGLALAQAAAGHYRIAIASDDTHTGNALCRRLHEDGHEALFIETI
AGEVRDIQRAVNRVLSRWQQLDVVVNLPGNMLVGPFEAAQTQQWQTLASQQLMQVVNSSQ
SALTAMKKQGYGSIINVVPDCGLLPGPLTSASSATYAAIIALTESLNSELANSPVNARAV
ALPLYQEQAEQLDATDPLSQARFKRKTRDSLNTAASLSGDILAMLKTPEATALHTPCAST
RAQWRLKRWFTKRWDKKMQQRGRRYRRKGTGESS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaatccccaaccctgctgattacccgaggctgcacaccgttaggtctggctcta
gcacaggctgctgccgggcactatcggattgcgatcgccagcgacgatacccataccggt
aacgcactgtgccgccgcttgcatgaagacggtcatgaagctctatttatcgagacaata
gcgggtgaagtgagggacattcagcgagccgtcaaccgggttctaagtcgctggcagcag
ctggatgtggtggttaatttacccggaaatatgctggtggggccttttgaagcggcgcag
actcagcaatggcaaacgctggccagccaacagttgatgcaagtagtaaacagcagtcag
agcgcgctaactgctatgaaaaaacaaggatatgggagcattattaatgtggtgcccgat
tgcggcctactccccgggccactcacctccgcaagcagtgcgacctatgcggccatcatc
gccctgaccgaaagcctaaatagcgagctggccaacagcccagtgaacgcccgggcagtt
gccctaccactctaccaggaacaagctgaacaattggatgctaccgatccgctcagccaa
gcccgcttcaaacgtaaaacccgtgacagtttaaatactgcggcttcactgagcggtgat
attctggctatgctaaaaacacctgaggccaccgccctgcatacgccctgcgcatccaca
cgggcacaatggagattgaagcgttggttcacaaagcgatgggacaaaaaaatgcagcaa
cgaggacgtcgctaccgccgtaagggaaccggggagtcttcttag

DBGET integrated database retrieval system