KEGG   Alcanivorax borkumensis: ABO_1493Help
Entry
ABO_1493          CDS       T00380                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00020  Citrate cycle (TCA cycle)
abo00640  Propanoate metabolism
abo00660  C5-Branched dibasic acid metabolism
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01200  Carbon metabolism
Module
abo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABO_1493 (sucC)
   00640 Propanoate metabolism
    ABO_1493 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ABO_1493 (sucC)
Enzymes [BR:abo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ABO_1493 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAL16941
UniProt: Q0VPF7
Position
complement(1702377..1703546)
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQSKQLFADYGLPVSTGFACDTPEEVAAKAKEIGGDKWVVKAQVHAGGRGKAGGV
KLVDTPEDAAAFAKKWLGKQLVTFQTDEHGQPVSKILVETCTDIAKELYLSAVLDRASRR
VVFMASTEGGVDIETVAEETPEKILKAEIDPLVGAQPYQAREIAFKLGLEGKQVNQFAKI
FVGLAKLFVDKDLALIEVNPLVITDTGDLHCLDAKINVDGSALYRHPDIKALDDPSQEDE
RERRAAEWDLNYVALEGNIGCMVNGAGLAMGTMDLVKLKGGAPANFLDVGGGATKERVTE
AFKIILSDDQVKGVLVNIFGGIVRCDLIAEGIIGAVEEVGVTVPVVVRLEGNNAELGSQK
LAESGMNIIAAQSFDDAAEQVVKAVGGAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccatgaatatcagtcaaaacagctttttgctgattatgggttgccagtctct
accggctttgcctgtgataccccggaagaggttgcagcaaaggcgaaagagatcggcggt
gacaagtgggtcgtaaaagcgcaagtgcacgctgggggccgaggtaaagctggcggtgta
aagctggtggatacaccggaagacgccgctgcctttgcaaagaagtggctgggcaagcag
ttagtgacctttcagaccgacgaacatggtcagccggtatcaaagattctggtagaaacc
tgcacggatattgctaaagaactgtatctgagcgcagtgctggaccgtgctagccgtcgt
gttgtgttcatggcttccaccgaaggtggcgtggatatcgaaacggttgcagaagaaacc
ccggaaaaaatcctcaaggcagagattgatccgctggtaggtgcacagccctatcaggcc
cgtgagatcgcatttaagttgggtctagaaggcaaacaggtcaatcagttcgccaagatc
ttcgtgggtctggcaaagctgtttgttgacaaagatctggcgctgatcgaagtgaacccg
ctggtgatcactgacaccggtgacctgcactgcttggatgccaaaatcaacgtcgatggc
tcggcgttatatcgccatccggacatcaaagccctagacgatcccagccaggaagatgag
cgcgagcgtcgcgctgcagaatgggatctgaactacgtcgctctagagggcaacatcggt
tgtatggtgaacggtgcaggtctagccatgggcaccatggatttggtgaagttgaagggc
ggtgcgccggccaacttcctagacgtgggcggtggcgccaccaaagagcgtgttaccgaa
gcgtttaagatcattctctccgatgatcaagtaaagggcgttctggtgaacatttttggt
ggtatcgttcgttgcgatttgatcgctgaaggtattatcggcgccgtggaagaagtgggc
gtaacggttcctgttgtggtgcgcttggagggcaacaatgcggagctgggttcccagaag
ctggcagaaagtggcatgaacatcattgccgcacaaagttttgatgatgctgccgagcag
gtagtgaaagcagtgggaggtgccgcatga

DBGET integrated database retrieval system