KEGG   Alcanivorax borkumensis: ABO_1495Help
Entry
ABO_1495          CDS       T00380                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
abo  Alcanivorax borkumensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABO_1495 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABO_1495 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ABO_1495 (sucB)
Enzymes [BR:abo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ABO_1495 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1705148..1706413)
Genome map
AA seq 421 aa AA seqDB search
MATDIKAPQFPESVADGTVATWHKQEGEAVKRDELLVDIETDKVVLEVVAPADGVVSKIM
AAEGETVESQQVLGTFDEGASGSAGSSNDKPAETDTKEASADHKEDAKSESADNSADDDD
SSGDQAGPAARKLMSEHGIAADQVKGTGRGGRITKGDVEKVITDKAQKRANQPAPQQPAT
LDVPGAPGEREERRVPMTRLRKRIAERLVSAQQDSAMLTTFNEVNMKPIMDMRKHYQPEF
EKAHNVRLGFMGFFTRACVEALKRFPAVNASIDGEDIVYHGYYDVGVAVSTERGLVVPVL
RDADQKGLAEVESQIIEYGQKAQKGKLSIEEMTGGTFTISNGGVFGSLISTPILNPPQTA
ILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGKEAVQFLVAVKNFIEDPARLLLD
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgatatcaaagctccacagtttcccgaatcagtagcagacggcaccgtggcc
acctggcacaagcaggaaggcgaagcggtgaagcgtgacgagctgctggtagatattgaa
accgacaaagttgtgctggaagtagtcgcacccgctgacggcgtggtcagtaagatcatg
gcggcagagggtgagaccgtggaaagccagcaagtgctgggtaccttcgatgaaggcgcc
agcggcagtgccggcagtagtaatgacaagcccgcagaaacggatactaaagaagcatca
gcggatcataaagaggatgcaaagtcagagagtgcggacaattctgccgatgacgatgat
agttccggtgatcaggcggggcctgccgctcgtaagctgatgagcgagcatggtattgct
gcagaccaagttaaaggcaccggtcgtggtggtcgcatcaccaaaggggatgttgaaaaa
gtcatcaccgacaaggcgcaaaaacgtgccaatcagcccgccccgcaacaaccggccacc
cttgatgtgccaggcgctccaggcgagcgtgaagagcgcagagttccaatgactcgcttg
cgtaagcgtattgctgagcgtttggtatcggctcaacaggactccgcaatgttgaccacc
tttaacgaggtcaacatgaaaccgatcatggatatgcgtaagcattaccagccggaattc
gagaaagcccataacgtgcgccttggcttcatgggcttctttacccgggcttgcgtggaa
gcgctgaaacgtttcccagcagtgaatgcgtctattgacggtgaagatatcgtttatcac
ggctactacgacgtgggcgtggcggtttctactgagcgaggcttggttgtgccggtgcta
cgtgacgcagaccagaaaggtctggcggaagtggagtcacagatcatcgaatatggtcag
aaggcccaaaagggcaagctatccattgaagagatgactggtggcacgtttaccatttcc
aacggtggggtgtttggttcgttgatttccacaccgattcttaacccgccgcagacggcc
attctggggatgcacaagatccaggaaaggcctatggcagtggacggtaaagtggaaatc
ctgccgatgatgtatttggccttatcctacgatcaccgcctcatcgatggtaaggaagcg
gtgcaatttctggttgccgtgaagaactttatcgaggacccggcgcggctgttgctggat
atctga

DBGET integrated database retrieval system