KEGG   Alcanivorax borkumensis: ABO_1495Help
Entry
ABO_1495          CDS       T00380                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00020  Citrate cycle (TCA cycle)
abo00310  Lysine degradation
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01200  Carbon metabolism
Module
abo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABO_1495 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ABO_1495 (sucB)
Enzymes [BR:abo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ABO_1495 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 Biotin_lipoyl_2 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAL16943
UniProt: Q0VPF5
Position
complement(1705148..1706413)
Genome map
AA seq 421 aa AA seqDB search
MATDIKAPQFPESVADGTVATWHKQEGEAVKRDELLVDIETDKVVLEVVAPADGVVSKIM
AAEGETVESQQVLGTFDEGASGSAGSSNDKPAETDTKEASADHKEDAKSESADNSADDDD
SSGDQAGPAARKLMSEHGIAADQVKGTGRGGRITKGDVEKVITDKAQKRANQPAPQQPAT
LDVPGAPGEREERRVPMTRLRKRIAERLVSAQQDSAMLTTFNEVNMKPIMDMRKHYQPEF
EKAHNVRLGFMGFFTRACVEALKRFPAVNASIDGEDIVYHGYYDVGVAVSTERGLVVPVL
RDADQKGLAEVESQIIEYGQKAQKGKLSIEEMTGGTFTISNGGVFGSLISTPILNPPQTA
ILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGKEAVQFLVAVKNFIEDPARLLLD
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgatatcaaagctccacagtttcccgaatcagtagcagacggcaccgtggcc
acctggcacaagcaggaaggcgaagcggtgaagcgtgacgagctgctggtagatattgaa
accgacaaagttgtgctggaagtagtcgcacccgctgacggcgtggtcagtaagatcatg
gcggcagagggtgagaccgtggaaagccagcaagtgctgggtaccttcgatgaaggcgcc
agcggcagtgccggcagtagtaatgacaagcccgcagaaacggatactaaagaagcatca
gcggatcataaagaggatgcaaagtcagagagtgcggacaattctgccgatgacgatgat
agttccggtgatcaggcggggcctgccgctcgtaagctgatgagcgagcatggtattgct
gcagaccaagttaaaggcaccggtcgtggtggtcgcatcaccaaaggggatgttgaaaaa
gtcatcaccgacaaggcgcaaaaacgtgccaatcagcccgccccgcaacaaccggccacc
cttgatgtgccaggcgctccaggcgagcgtgaagagcgcagagttccaatgactcgcttg
cgtaagcgtattgctgagcgtttggtatcggctcaacaggactccgcaatgttgaccacc
tttaacgaggtcaacatgaaaccgatcatggatatgcgtaagcattaccagccggaattc
gagaaagcccataacgtgcgccttggcttcatgggcttctttacccgggcttgcgtggaa
gcgctgaaacgtttcccagcagtgaatgcgtctattgacggtgaagatatcgtttatcac
ggctactacgacgtgggcgtggcggtttctactgagcgaggcttggttgtgccggtgcta
cgtgacgcagaccagaaaggtctggcggaagtggagtcacagatcatcgaatatggtcag
aaggcccaaaagggcaagctatccattgaagagatgactggtggcacgtttaccatttcc
aacggtggggtgtttggttcgttgatttccacaccgattcttaacccgccgcagacggcc
attctggggatgcacaagatccaggaaaggcctatggcagtggacggtaaagtggaaatc
ctgccgatgatgtatttggccttatcctacgatcaccgcctcatcgatggtaaggaagcg
gtgcaatttctggttgccgtgaagaactttatcgaggacccggcgcggctgttgctggat
atctga

DBGET integrated database retrieval system