KEGG   Alcanivorax borkumensis: ABO_1499Help
Entry
ABO_1499          CDS       T00380                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
abo  Alcanivorax borkumensis
Pathway
abo00020  Citrate cycle (TCA cycle)
abo00190  Oxidative phosphorylation
abo00650  Butanoate metabolism
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01200  Carbon metabolism
Module
abo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABO_1499 (sdhD)
   00650 Butanoate metabolism
    ABO_1499 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ABO_1499 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAL16947
UniProt: Q0VPF1
Position
complement(1712160..1712531)
Genome map
AA seq 123 aa AA seqDB search
MVTSVTSLGRNGLYDWLIQRVSAVIIGVYMIGMLGYLITVGDLDYSSWKAFMGSICMQIA
NTLLVISVVAHTWVGVWGVTTDYLTSLTFGKAATGVRLIAQVAIALALVVYLLWGLVLIW
GGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagtgtaacgagcctggggcgtaatggcctgtatgactggctgattcagcga
gtttccgctgtcatcatcggtgtctatatgatcggcatgctgggctacctgatcacagtg
ggtgaccttgactacagcagctggaaagccttcatgggatctatctgcatgcagatagcc
aataccttgctggtaatttctgtcgttgcacatacctgggttggtgtgtggggcgtaacc
actgactacctgactagcctgacctttggtaaagcggctaccggtgttcgcttgattgcc
caggtggcaattgcattggcgctggttgtttacctgctgtggggtcttgttttgatctgg
ggaggggcgtaa

DBGET integrated database retrieval system