KEGG   Alcanivorax borkumensis: ABO_1499Help
Entry
ABO_1499          CDS       T00380                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
abo  Alcanivorax borkumensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABO_1499 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABO_1499 (sdhD)
   00650 Butanoate metabolism
    ABO_1499 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ABO_1499 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1712160..1712531)
Genome map
AA seq 123 aa AA seqDB search
MVTSVTSLGRNGLYDWLIQRVSAVIIGVYMIGMLGYLITVGDLDYSSWKAFMGSICMQIA
NTLLVISVVAHTWVGVWGVTTDYLTSLTFGKAATGVRLIAQVAIALALVVYLLWGLVLIW
GGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagtgtaacgagcctggggcgtaatggcctgtatgactggctgattcagcga
gtttccgctgtcatcatcggtgtctatatgatcggcatgctgggctacctgatcacagtg
ggtgaccttgactacagcagctggaaagccttcatgggatctatctgcatgcagatagcc
aataccttgctggtaatttctgtcgttgcacatacctgggttggtgtgtggggcgtaacc
actgactacctgactagcctgacctttggtaaagcggctaccggtgttcgcttgattgcc
caggtggcaattgcattggcgctggttgtttacctgctgtggggtcttgttttgatctgg
ggaggggcgtaa

DBGET integrated database retrieval system