KEGG   Alcanivorax borkumensis: ABO_1567Help
Entry
ABO_1567          CDS       T00380                                 

Gene name
fadA
Definition
(GenBank) Acetyl CoA acetyltransferase (thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abo  Alcanivorax borkumensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABO_1567 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    ABO_1567 (fadA)
   00640 Propanoate metabolism
    ABO_1567 (fadA)
   00650 Butanoate metabolism
    ABO_1567 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_1567 (fadA)
   00072 Synthesis and degradation of ketone bodies
    ABO_1567 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABO_1567 (fadA)
   00310 Lysine degradation
    ABO_1567 (fadA)
   00380 Tryptophan metabolism
    ABO_1567 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABO_1567 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABO_1567 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABO_1567 (fadA)
Enzymes [BR:abo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABO_1567 (fadA)
Exosome [BR:abo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABO_1567 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1789422..1790633)
Genome map
AA seq 403 aa AA seqDB search
MTEAYIYDAIRTPRGRGKKDGSLHTVKPLDLVVGLIDEVKDRFPNMDTNSIDDVLLGVVT
PVGDQGACIAKTAALAAGLPDTVAGLQMNRFCASGLEAVNTGAQKVASGWDDLILAGGVE
SMSRIPMGSDGGAWAMDPITNYKTGFVPQGIGADLIATLEGWSRRDVDEFAAESQARAVN
AWEKGYFDKSVVPVKDINGMTVLDRDEHVRAGTTADALAGLNPSFAMMGEMGGFDAVALQ
KYHWVEKINHVHHAGNSSGIVDGASLLVLGNEKVGKDFGMKARGRIVSTAISGADPTIML
TGPGPAAKKALAKAGLKASDIDLWEINEAFAAVAMRFMKDMDITPDVTNVNGGSIAMGHP
LGATGAMIVGIALDELERRDKKFALCTLCVGGGMGIATIIERL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctatatctatgatgccattcgtactccccgtggtcggggtaagaaagat
ggctctttgcatacggttaagccgctggatctcgtagtaggcctgatcgatgaagtaaaa
gatcgttttccaaatatggataccaatagcattgatgatgtgctgttgggtgtggtgact
ccggtcggtgaccagggtgcctgtattgccaaaacagcagctctggctgctgggttgcca
gatactgtagcgggtttgcagatgaaccgtttctgcgcctctggcctggaagcagtgaat
accggtgcccagaaagtggcctccggttgggatgacctgattctcgccggtggtgtggaa
tccatgagccgtatccccatgggctctgacggtggtgcctgggcaatggacccgatcacc
aactacaagactggctttgttccccaggggattggcgcggatctgattgccactctcgaa
ggctggagccgccgtgatgtggacgaatttgctgctgagtcccaggcccgtgctgtgaat
gcgtgggaaaagggttatttcgataaatctgtggtgccggtgaaagacattaacggcatg
acagtgctggatcgtgacgagcacgttcgcgcgggcaccactgctgatgcgctggcaggc
ctgaacccgtctttcgcaatgatgggcgaaatgggcggttttgatgcggttgctttgcag
aagtatcactgggtggaaaagattaaccacgttcaccacgcaggtaactcctccggtatc
gtggatggtgcttctctgctggtgctgggtaacgaaaaagtgggcaaggacttcggcatg
aaagcccgtggccggattgtcagcaccgcgatcagtggtgccgatcccaccatcatgttg
acgggcccaggtccggcggctaagaaagcgctggcgaaagccggcttgaaagccagcgat
attgatctgtgggaaatcaacgaagcctttgcggcggtcgccatgcgctttatgaaagac
atggacatcaccccggacgttaccaacgtcaatggtggctccatcgccatgggccacccg
ttgggagctactggcgccatgattgtgggtattgcactggatgaactcgagcgccgcgac
aagaagttcgcattgtgcaccctgtgtgtgggcggtggcatgggtatcgctaccatcatc
gagcgtctgtaa

DBGET integrated database retrieval system