KEGG   Alcanivorax borkumensis: ABO_1652Help
Entry
ABO_1652          CDS       T00380                                 

Gene name
fadB2
Definition
(GenBank) fatty oxidation complex
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00071  Fatty acid degradation
abo00280  Valine, leucine and isoleucine degradation
abo00281  Geraniol degradation
abo00310  Lysine degradation
abo00362  Benzoate degradation
abo00380  Tryptophan metabolism
abo00410  beta-Alanine metabolism
abo00640  Propanoate metabolism
abo00650  Butanoate metabolism
abo00903  Limonene and pinene degradation
abo00930  Caprolactam degradation
abo01040  Biosynthesis of unsaturated fatty acids
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01200  Carbon metabolism
abo01212  Fatty acid metabolism
Module
abo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABO_1652 (fadB2)
   00650 Butanoate metabolism
    ABO_1652 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_1652 (fadB2)
   01040 Biosynthesis of unsaturated fatty acids
    ABO_1652 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABO_1652 (fadB2)
   00310 Lysine degradation
    ABO_1652 (fadB2)
   00380 Tryptophan metabolism
    ABO_1652 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABO_1652 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABO_1652 (fadB2)
   00281 Geraniol degradation
    ABO_1652 (fadB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABO_1652 (fadB2)
   00930 Caprolactam degradation
    ABO_1652 (fadB2)
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ABO_1652 (fadB2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABO_1652 (fadB2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ABO_1652 (fadB2)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ABO_1652 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CAL17100
UniProt: Q0VNZ8
Position
1888793..1890940
Genome map
AA seq 715 aa AA seqDB search
MIYQGNAVSVQLLDDGIAELKFDLQGESVNKFNQETVEDLGKAVEAVKTNSDIKGLIVTS
GKGVFIVGADITEFTDMFKLPEDEIASWCLKSNEVFNALEDLDIPKVAAVNGIALGGGLE
LCLAADFRVLSEKAQVGLPEVKLGLYPGFGGTVRLPRVIGVDNAVEWIAAGGQHKADKAL
SVGVADAVVAHDELQNAAIDLVKQCLAGKIDFRAKRAEKLEPLKLPPMENMMAFQTCTAM
VMGQAGKNYPAPVAAVNAMQKHAGMNRKEAQEVEAKGFAKVAKSPQATCMVGLFLADQQV
KKVNGKTAKASKEINQAAVLGAGIMGGGIAFQSASKGTPIIMKDIADKALDLGMSEASKL
LTKRVDRKKMKPAKMAQVLSSIRPTLNYGDFANVNVVVEAVVENQKVKQSVLAEVEDKVT
EGTVLASNTSTISITKLAEALKRPQDFAGMHFFNPVHMMPLVEVIRGEKTSDETVGTLVA
YAQKMGKTPIVVNDCPGFLVNRVLFPYFGGFGMLMRDGADFQAVDKVMQKFGWPMGPAYL
MDVVGIDTGVHAAEVMAEGYPERMQYDFKDASTVMFENDRYGQKNGVGFYKYELDKKGKT
KKVVDESTYELIKPHVADSKEFDAEEIIARMMIPMCTETVRCLEDNIVGSAAEADMAMIY
GIGFPPFRGGPLRYIDSVGVKEFVALCDKYAHLGGIYEAPQMLKDMASKGESFFA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaggcaacgccgtaagcgtacaactgcttgacgacggcatcgccgaactg
aagtttgaccttcagggcgagtccgttaacaagttcaatcaggaaaccgtggaagacctc
ggtaaggctgtggaagctgttaaaacgaacagcgacatcaaaggcctaatcgtgacttcc
ggcaaaggggttttcattgttggcgccgacatcaccgaattcaccgacatgttcaaactg
ccggaagatgaaatcgccagctggtgtctgaaatctaacgaagtcttcaacgcccttgaa
gatctcgacattcccaaagtggcggccgttaatggcatcgccttgggtggtggcttagaa
ctgtgtctggccgcagatttccgcgtactgagcgaaaaagctcaggtcggtctgccggaa
gtgaaactgggcttgtacccgggcttcggcggcaccgtgcgcttgccccgcgtaattggt
gtagataatgccgttgagtggatcgccgctggcggtcagcacaaagcggacaaagcgctg
agcgtaggtgtagccgacgcggtcgttgcccacgacgaactgcagaacgcggccatcgat
ctggtcaagcaatgcctagccggcaaaatcgatttccgcgccaagcgtgccgagaaactg
gaaccgctgaaactgccacccatggaaaacatgatggccttccagacttgcaccgccatg
gtgatgggccaggcaggcaagaactacccggccccggtagccgccgtaaacgccatgcaa
aagcatgctggcatgaaccgcaaagaagcacaggaagtggaagccaaaggcttcgccaaa
gtggccaagtctccgcaagccacctgcatggttgggctgttcctggcagaccagcaagtg
aaaaaggtcaacggcaaaaccgctaaagcctccaaagagatcaatcaggccgccgtactg
ggcgcaggcatcatgggcggcggtatcgccttccagtctgcctctaaaggcacgccgatc
atcatgaaggacatcgccgacaaagcgctggacctgggcatgagcgaagccagcaaactg
ctgaccaagcgtgttgatcgcaagaaaatgaagcccgccaaaatggcgcaggttttgtcc
tctatccgtccgaccctgaactacggcgacttcgccaacgtgaacgtggtggttgaggcg
gtagttgagaaccagaaggtcaagcagtccgtattggcggaagtggaagataaggtaacc
gagggcaccgtgctggcctccaacacctccaccatttccatcaccaaactggctgaagcc
ctgaagcgtccgcaagacttcgccggcatgcacttcttcaacccggtacacatgatgccg
ctggtggaagtaatccgtggcgaaaagacctccgacgaaaccgttggcaccctggtggcc
tacgctcagaaaatgggcaaaacccccatcgtggttaacgactgccccggcttcctggtt
aaccgtgtactgttcccctacttcggcggcttcggcatgctgatgcgcgacggtgccgac
ttccaggcggtcgacaaagtgatgcagaagttcggctggcctatgggcccggcgtacctg
atggacgtggttggcatcgacaccggtgttcacgcggctgaggtaatggctgaaggctac
cccgagcgcatgcagtacgacttcaaagatgcgtccactgtgatgttcgaaaacgatcgt
tacggccagaaaaacggcgtcggtttctacaagtacgagctggacaagaaaggcaaaacc
aaaaaggttgtcgacgagtccacctacgaactgatcaagccgcacgtggctgacagcaag
gaattcgatgcggaagaaatcatcgcccgcatgatgatccccatgtgcaccgaaaccgtt
cgctgcctggaagacaacatcgtaggttccgctgccgaggccgacatggccatgatctac
ggcatcggcttccctcccttccgtggcggtccgctgcgttacatcgacagtgttggcgtt
aaagaattcgtcgcgctgtgtgacaagtacgcgcacctgggtggcatctacgaagcaccg
cagatgctcaaagacatggcctccaagggcgagtctttcttcgcctaa

DBGET integrated database retrieval system