KEGG   Alcanivorax borkumensis: ABO_1769Help
Entry
ABO_1769          CDS       T00380                                 

Gene name
gpm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:abo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:abo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:abo00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:abo00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:abo00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2016170..2016916
Genome map
AA seq 248 aa AA seqDB search
MSTKLVLVRHGQSVWNKENRFTGWKDVDLTEQGREEARTAGELLKEAGFEFDLAYTSVLK
RAIRTLWSILDNMDQMWIPVIRDYRLNERHYGALQGLNKAETAAKYGDDQVHIWRRSYDT
PPPKMERDDERYAGNFRVYKDLSEAQIPLSESLKDTVDRFIPYFESDIKPQIQAGKQVLI
CAHGNSLRALVKYLGDISDEEIVKLNIPTGVPMVYELDDNLKPIKNYYLGDAEAAAKAAE
AVANQGKA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaaactggtactggtccgccacggccagagcgtatggaacaaggaaaatcgc
ttcacaggctggaaagatgttgatcttaccgagcaaggccgcgaagaagcccgcaccgca
ggcgaactactgaaagaggccgggtttgaatttgacctggcttatacctcggtgctcaag
cgtgcgatccgcaccctgtggagcattctggataacatggaccagatgtggatccctgtt
atccgtgactaccgcttgaatgaacgccactacggtgccttgcagggtttgaataaagcg
gaaacagccgccaaatatggcgacgaccaggtacatatatggcgccgtagctacgatacg
ccgccaccgaaaatggaacgtgacgatgagcgctacgctggcaacttccgagtgtacaag
gacttgagtgaagctcaaattcctttgtcagaaagtcttaaagacacggtggaccgtttt
attccttacttcgaaagtgatatcaaaccgcaaattcaagctgggaaacaggttttaatc
tgcgcccatggcaatagtctgcgtgcgctggtgaagtatctcggcgacatttctgacgaa
gaaatcgtaaagctcaacatccctactggagtgccgatggtttatgagctggacgacaat
ctcaaacccattaaaaactactatttgggcgatgccgaagctgcagcgaaagcggcagaa
gcagtcgccaaccaaggtaaggcgtaa

DBGET integrated database retrieval system