KEGG   Alcanivorax borkumensis: ABO_1820Help
Entry
ABO_1820          CDS       T00380                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
abo  Alcanivorax borkumensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABO_1820 (recD)
Enzymes [BR:abo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ABO_1820 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2078553..2080490
Genome map
AA seq 645 aa AA seqDB search
MQADLFSALTWEDALILLRDNNLLRDLDVAIARFLKQQCPQASYEVLLLAAFTSNQQASG
HLCLDLKNRALATQLWGTNPPPELVALLPGEPNNWLHELQQSTLVSQNGSTPLVLDGSRL
YLRRNWAREVAVADAIEQKLATANPLPEAPLREALAKLFPGSNNHTDWQQVACALASRSG
ISIITGGPGTGKTTTVVRLLGLLQSLAMADNQRLRIRLAAPTGKAAARLTESIGEQVGKL
HVDATVRDAIPTEVTTLHRLLGTRPDSRHFRHHGDNPLHADLVVVDEASMIDMDMMACLL
EALSPHTRLILLGDKDQLASVEAGAVMGDLCRHAHEGRYKQRTIEFVNNTCGADISDYQE
TDQNPGNALAQQTAMLRTNWRSKDSPGIGELARAVNEENLPQVRESFQRYPDSLYRQHLS
SDSQQLETLLLNGSNGHTGLRALFSAVATPPAQRHDFDDWAAGLLKQLTHQQLLSGLRSG
PFGVEQLNQRITHHLQQQDLAPEREWYPGRPVMMTRNDYQLGLMNGDVGLTLPLLETRKG
TAELLLRVAFQLPDGRIKWVLPSRLDGVETVYAMTVHKSQGSEFKHTLLVLPDAPHPLLT
RELIYTAVTRARDRFTLLEFGKSAVLDSAVKKRTWRASGLAERLS
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgacctgttctccgccctcacctgggaagacgcgctaatcctgctgcgcgac
aacaatttgctgcgcgatctggacgtggccattgcccgtttcctgaaacaacaatgcccg
caagcaagctacgaggtgttattactcgccgccttcaccagcaaccagcaagccagtggc
cacctgtgtctggatctaaaaaaccgcgcgttagccacccagctttggggcaccaacccg
ccgccggagctggtcgccctgttacccggcgagcccaataactggctccatgaactgcag
caaagcaccttggtcagccaaaacggcagcacaccattggtactggacggcagccgcctt
tacctgcgccgcaactgggcccgggaagtggccgtggccgacgccatcgagcaaaaactg
gccaccgccaatccactgcctgaagcccccctgcgcgaagccctggccaaattatttccc
ggttccaacaaccacaccgactggcaacaggtggcttgtgctttggccagccgcagcggg
atcagcatcattaccggcggccccggcaccggcaaaaccaccacagtggtacgcttgtta
ggcctgctgcaaagcctggcaatggccgataaccagcgcctgcgtattcgtctcgccgct
cccaccggcaaggctgcggcacggctcaccgaatccatcggtgagcaggtaggaaaactc
cacgtggacgccaccgtgcgcgatgccattcccaccgaagtgaccacactgcaccgcctg
ctcggcacccggccagacagccgtcactttcgccatcatggggataatccactgcacgca
gatctggtggtggtggatgaagccagcatgatcgacatggacatgatggcttgcctgttg
gaagccctgagcccacacacccggttgattctactcggcgataaggaccaactggccagc
gtggaagccggtgcggtgatgggtgacttgtgccgtcatgcccacgaaggtcgctacaag
caacgtactatcgaattcgttaacaatacctgtggcgcggatatcagtgactatcaggag
acagaccagaacccaggcaacgccctagcgcaacaaaccgccatgttgcgcaccaactgg
cgctccaaggacagccccggcatcggcgaactggcgcgggcagtaaacgaagaaaacctg
ccgcaggtgcgcgagagctttcaacgctacccggacagcctgtaccgccaacacctgagc
agcgatagccagcaactggaaaccctgctgctcaacggcagtaatggtcacacaggccta
cgggcactgtttagcgcggtggcaacaccacctgcacagcgacacgatttcgatgattgg
gccgccggcctgctcaaacagctcacccaccagcaactgctcagcggcctgcgcagcggt
cctttcggggtagaacaactcaatcaacgcatcacccaccacctacaacaacaggacctg
gcgccggaacgggaatggtaccccggtcgcccggtgatgatgacgcgcaacgattatcag
ctagggttaatgaatggcgatgtgggactgacgctgcccttacttgagaccaggaagggt
accgcggagctgctgttaagagtggcgttccagttgccggacgggcgcatcaagtgggta
ttacccagccgcctggacggggtagaaaccgtctacgccatgaccgtacacaaatcccaa
ggctcggaattcaagcataccctgctggtattacccgatgccccccaccccctgcttacc
cgagagttaatctacactgccgtcacccgggctcgggatcgcttcaccttgctggaattc
ggcaaatcggccgtgctggacagtgcggtgaaaaagcggacttggcgggcatcggggtta
gcagagaggttgagttaa

DBGET integrated database retrieval system