KEGG   Alcanivorax borkumensis: ABO_1989Help
Entry
ABO_1989          CDS       T00380                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00010  Glycolysis / Gluconeogenesis
abo00030  Pentose phosphate pathway
abo00051  Fructose and mannose metabolism
abo00052  Galactose metabolism
abo00680  Methane metabolism
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABO_1989 (pfkA)
   00030 Pentose phosphate pathway
    ABO_1989 (pfkA)
   00051 Fructose and mannose metabolism
    ABO_1989 (pfkA)
   00052 Galactose metabolism
    ABO_1989 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ABO_1989 (pfkA)
Enzymes [BR:abo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ABO_1989 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     ABO_1989 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Cu-oxidase_4
Motif
Other DBs
NCBI-ProteinID: CAL17437
UniProt: Q0VN11
Position
2275917..2277179
Genome map
AA seq 420 aa AA seqDB search
MARKNAFYAQSGGVTAVINASAAGVIEAARENKDVIGKVYAGRNGIIGALTEELIDTSKE
SKSAIEALKHTPGGAFGSCRYKLKDLKTSQREYERLIEVFKAHNIGYFFYNGGGDSADTC
LKVSQLSEKMGYPIQAIHVPKTVDNDLPFTDVSPGFGSVAKYTAVSCREAALDVASMCAT
STKVFVMEVMGRHAGWIAASAGLAKEDADDAPHLILFPEIAFDKAAFMKKVEATVKKAGY
CVIVVSEGARYEDGTFLADAGNTDAFGHKQLGGVAPVIAQMVKDELGYKYHWAVSDYLQR
AARHIASATDVEQAYAVGRAAVEFAVAGKNAVMPTVVRKDTKKYSWTIGEAPLKKVANVE
KKMPRKYISKDGFGITPAARAYLEPLIGGESYPPYKNGLPQFAKLKLAPVEKKLNDAFEV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaaaaacgctttctatgctcagtccggcggtgttactgccgtcatcaatgct
tctgctgccggcgttattgaagcagcacgagaaaacaaggatgtgatcggcaaagtctac
gccggccggaatggcatcatcggcgcactcactgaagagctgatcgatacaagcaaagaa
agcaaaagcgccattgaagcgctcaagcacacccccggcggggccttcggttcttgccgc
tataagctgaaagacctcaagacctcccaacgcgaatacgaacgtctaatcgaagtcttc
aaggctcacaacatcggctacttcttctataacggtggtggtgattccgccgacacctgc
ctaaaagtatcacagctttccgagaaaatgggctacccgatccaggctatccacgtgccc
aaaaccgtggacaacgacctgcccttcaccgacgtgagccctggtttcggttccgtcgcc
aagtacaccgctgtgagctgccgtgaggccgccctggacgtggccagcatgtgcgccacc
tccaccaaggtgttcgtgatggaagtcatgggccgtcacgctggctggatcgccgcctcc
gccgggctcgccaaagaggatgccgatgacgctccgcacctaatcttgttcccggaaatt
gccttcgacaaagcggccttcatgaaaaaggtggaagccaccgtcaagaaagcgggctat
tgcgtcattgtggtgtccgaaggggctcgctatgaagacggcacgttcttggccgacgcg
ggtaacactgacgcctttggccacaaacagctaggcggtgtggctccggtcatcgctcag
atggtgaaagacgaactcggctacaaataccactgggctgtaagcgattacttacagcgt
gccgcacgccacatagcatcagccactgacgtggagcaagcctacgcagtgggccgcgcc
gccgttgagttcgccgtggcgggtaaaaacgcagtcatgcccaccgtggttcgcaaggac
acaaaaaaatacagctggaccatcggcgaagcgccgctaaagaaagtggccaatgtagaa
aagaaaatgccgcgtaaatacattagcaaagatggtttcggcattacccccgcggcccga
gcctacctagagcctttgattggtggtgaatcctaccctccctacaaaaacgggctgccg
caatttgccaaactaaaactagccccagtcgagaaaaagttaaacgatgcttttgaggtc
taa

DBGET integrated database retrieval system