KEGG   Alcanivorax borkumensis: ABO_1989Help
Entry
ABO_1989          CDS       T00380                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABO_1989 (pfkA)
   01230 Biosynthesis of amino acids
    ABO_1989 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABO_1989 (pfkA)
   00030 Pentose phosphate pathway
    ABO_1989 (pfkA)
   00051 Fructose and mannose metabolism
    ABO_1989 (pfkA)
   00052 Galactose metabolism
    ABO_1989 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ABO_1989 (pfkA)
Enzymes [BR:abo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ABO_1989 (pfkA)
Protein phosphatases and associated proteins [BR:abo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ABO_1989 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2275917..2277179
Genome map
AA seq 420 aa AA seqDB search
MARKNAFYAQSGGVTAVINASAAGVIEAARENKDVIGKVYAGRNGIIGALTEELIDTSKE
SKSAIEALKHTPGGAFGSCRYKLKDLKTSQREYERLIEVFKAHNIGYFFYNGGGDSADTC
LKVSQLSEKMGYPIQAIHVPKTVDNDLPFTDVSPGFGSVAKYTAVSCREAALDVASMCAT
STKVFVMEVMGRHAGWIAASAGLAKEDADDAPHLILFPEIAFDKAAFMKKVEATVKKAGY
CVIVVSEGARYEDGTFLADAGNTDAFGHKQLGGVAPVIAQMVKDELGYKYHWAVSDYLQR
AARHIASATDVEQAYAVGRAAVEFAVAGKNAVMPTVVRKDTKKYSWTIGEAPLKKVANVE
KKMPRKYISKDGFGITPAARAYLEPLIGGESYPPYKNGLPQFAKLKLAPVEKKLNDAFEV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaaaaacgctttctatgctcagtccggcggtgttactgccgtcatcaatgct
tctgctgccggcgttattgaagcagcacgagaaaacaaggatgtgatcggcaaagtctac
gccggccggaatggcatcatcggcgcactcactgaagagctgatcgatacaagcaaagaa
agcaaaagcgccattgaagcgctcaagcacacccccggcggggccttcggttcttgccgc
tataagctgaaagacctcaagacctcccaacgcgaatacgaacgtctaatcgaagtcttc
aaggctcacaacatcggctacttcttctataacggtggtggtgattccgccgacacctgc
ctaaaagtatcacagctttccgagaaaatgggctacccgatccaggctatccacgtgccc
aaaaccgtggacaacgacctgcccttcaccgacgtgagccctggtttcggttccgtcgcc
aagtacaccgctgtgagctgccgtgaggccgccctggacgtggccagcatgtgcgccacc
tccaccaaggtgttcgtgatggaagtcatgggccgtcacgctggctggatcgccgcctcc
gccgggctcgccaaagaggatgccgatgacgctccgcacctaatcttgttcccggaaatt
gccttcgacaaagcggccttcatgaaaaaggtggaagccaccgtcaagaaagcgggctat
tgcgtcattgtggtgtccgaaggggctcgctatgaagacggcacgttcttggccgacgcg
ggtaacactgacgcctttggccacaaacagctaggcggtgtggctccggtcatcgctcag
atggtgaaagacgaactcggctacaaataccactgggctgtaagcgattacttacagcgt
gccgcacgccacatagcatcagccactgacgtggagcaagcctacgcagtgggccgcgcc
gccgttgagttcgccgtggcgggtaaaaacgcagtcatgcccaccgtggttcgcaaggac
acaaaaaaatacagctggaccatcggcgaagcgccgctaaagaaagtggccaatgtagaa
aagaaaatgccgcgtaaatacattagcaaagatggtttcggcattacccccgcggcccga
gcctacctagagcctttgattggtggtgaatcctaccctccctacaaaaacgggctgccg
caatttgccaaactaaaactagccccagtcgagaaaaagttaaacgatgcttttgaggtc
taa

DBGET integrated database retrieval system