KEGG   Alcanivorax borkumensis: ABO_2104Help
Entry
ABO_2104          CDS       T00380                                 

Gene name
pldA
Definition
outer membrane phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ABO_2104 (pldA)
   00565 Ether lipid metabolism
    ABO_2104 (pldA)
   00590 Arachidonic acid metabolism
    ABO_2104 (pldA)
   00591 Linoleic acid metabolism
    ABO_2104 (pldA)
   00592 alpha-Linolenic acid metabolism
    ABO_2104 (pldA)
Enzymes [BR:abo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ABO_2104 (pldA)
    3.1.1.32  phospholipase A1
     ABO_2104 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2409879..2410916
Genome map
AA seq 345 aa AA seqDB search
MHIRLMFALALASSLLCAEEPANNDPPVPDSPAINMTEEQKLNNCLLRSAQTANGNVTLH
EMRGWCTNGEEQERISSHENALRARLALENTTRGNPFVITPHRRNYLMPYSYWSNRQWND
PTKKDSDLQPSEVKFQLSLKAPIKEKIFDDITLWMAFTGTFYWQAYNSDLSAPFREANYE
PELFITKPIDWQIGPLDSELLALGFNHQSNGQDVPVSRSWNRIFMNYVFKTGDYYWSFKP
WYRIPEDKKDSPTDAGGDDNPDIEKYMGNFELEVAHPFGNHVVELMLRNNLRSENKGAGR
LNYSFPLSKRFKGLVQVFSGYGDSLINYDNYENRYSFGILLTDSL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcatatccgccttatgttcgccctagcgctggccagctcccttctttgcgccgaggag
ccggccaataacgatcctcctgtacccgacagcccagccatcaacatgacagaagagcaa
aagctcaataactgtctgttacgcagtgcccagaccgctaatggcaatgtaacactgcac
gaaatgcgcggttggtgtacgaacggcgaagaacaagagagaatcagtagccatgagaac
gccctgcgagccaggctggcactggaaaataccacccgcggcaatccctttgtcatcacc
cctcatcgccgaaactacctgatgccgtatagttactggtccaatcggcagtggaacgac
cccaccaagaaggacagtgatctacaaccctctgaggtcaaatttcagttatcgctgaaa
gcccctatcaaagaaaagattttcgatgacattaccctttggatggcctttaccggcacg
ttctattggcaggcttacaacagtgacctctcggccccattccgtgaagccaattacgag
ccggaattattcattaccaaaccgattgattggcaaatcggacctctagattcggagcta
ttggcgctagggttcaaccatcagtccaacggccaggatgtgcccgtttcacgtagctgg
aaccgtatcttcatgaactatgtgttcaagacaggggattactactggtccttcaaacct
tggtatcgcattcctgaagataaaaaagactcccccacagatgccggcggtgacgacaac
ccggatatcgaaaagtacatgggcaatttcgaactggaagtcgcacacccattcggcaac
cacgtggtcgaactgatgctacgcaacaatctacgttcggagaataagggcgcaggccgc
ctcaattactcattcccgctaagcaaacgcttcaaaggcttggtgcaggttttctccggg
tacggggattcactgattaattacgacaattatgagaaccgctacagcttcgggatcctg
ttgacggattctctatag

DBGET integrated database retrieval system