KEGG   Alcanivorax borkumensis: ABO_2104Help
Entry
ABO_2104          CDS       T00380                                 

Gene name
pldA
Definition
outer membrane phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
abo  Alcanivorax borkumensis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:abo00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:abo00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:abo00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:abo00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:abo00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2409879..2410916
Genome map
AA seq 345 aa AA seqDB search
MHIRLMFALALASSLLCAEEPANNDPPVPDSPAINMTEEQKLNNCLLRSAQTANGNVTLH
EMRGWCTNGEEQERISSHENALRARLALENTTRGNPFVITPHRRNYLMPYSYWSNRQWND
PTKKDSDLQPSEVKFQLSLKAPIKEKIFDDITLWMAFTGTFYWQAYNSDLSAPFREANYE
PELFITKPIDWQIGPLDSELLALGFNHQSNGQDVPVSRSWNRIFMNYVFKTGDYYWSFKP
WYRIPEDKKDSPTDAGGDDNPDIEKYMGNFELEVAHPFGNHVVELMLRNNLRSENKGAGR
LNYSFPLSKRFKGLVQVFSGYGDSLINYDNYENRYSFGILLTDSL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcatatccgccttatgttcgccctagcgctggccagctcccttctttgcgccgaggag
ccggccaataacgatcctcctgtacccgacagcccagccatcaacatgacagaagagcaa
aagctcaataactgtctgttacgcagtgcccagaccgctaatggcaatgtaacactgcac
gaaatgcgcggttggtgtacgaacggcgaagaacaagagagaatcagtagccatgagaac
gccctgcgagccaggctggcactggaaaataccacccgcggcaatccctttgtcatcacc
cctcatcgccgaaactacctgatgccgtatagttactggtccaatcggcagtggaacgac
cccaccaagaaggacagtgatctacaaccctctgaggtcaaatttcagttatcgctgaaa
gcccctatcaaagaaaagattttcgatgacattaccctttggatggcctttaccggcacg
ttctattggcaggcttacaacagtgacctctcggccccattccgtgaagccaattacgag
ccggaattattcattaccaaaccgattgattggcaaatcggacctctagattcggagcta
ttggcgctagggttcaaccatcagtccaacggccaggatgtgcccgtttcacgtagctgg
aaccgtatcttcatgaactatgtgttcaagacaggggattactactggtccttcaaacct
tggtatcgcattcctgaagataaaaaagactcccccacagatgccggcggtgacgacaac
ccggatatcgaaaagtacatgggcaatttcgaactggaagtcgcacacccattcggcaac
cacgtggtcgaactgatgctacgcaacaatctacgttcggagaataagggcgcaggccgc
ctcaattactcattcccgctaagcaaacgcttcaaaggcttggtgcaggttttctccggg
tacggggattcactgattaattacgacaattatgagaaccgctacagcttcgggatcctg
ttgacggattctctatag

DBGET integrated database retrieval system