KEGG   Alcanivorax borkumensis: ABO_2374Help
Entry
ABO_2374          CDS       T00380                                 

Gene name
ccpR
Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
abo  Alcanivorax borkumensis
Brite
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ABO_2374 (ccpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2698443..2699651
Genome map
AA seq 402 aa AA seqDB search
MMKKPFLLLAGQSPGLFLVLGTLLLSGCPEQSETRVDDQGASYSAYDWQLPENIPLPREP
ADNPMTEEKFQLGRHLFYDKRLSVNGTISCSSCHHQDKAFSDGVDRPAGATGTLHPRNSQ
ALVNVAWYNTLTWGNPVLSTIEQQIMLPLFGDDPIEHGINGANSEQILMNLQSDPVYAPL
FAAAFPEQDEPLFGDTAYSNIVKSLASFVRGLASFNSPFDRNELSASAKRGSALFNSEKL
ECFHCHGTYNFSDATVDRRTSYIEAQFHNNGLYNIDGLGGYPEPNTGRYELTGKAHHMGQ
FRAPSLRNVALSAPYNHDGSVETLEQVIRNYAAGGRNITSGPNTGDGRMSPYKDSFIVSF
SISDSEIADVVAFLESLTDEEFINNPRFSNPWTESSPQDTTP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaagccatttctcctgttggccgggcaatcgcccggccttttccttgtgctc
ggcacgctgctcctaagcggctgcccagagcagagcgaaacccgggtagatgatcaaggc
gcgtcctactccgcctatgactggcaactcccggaaaacattccgctgccccgcgaaccg
gcggacaacccgatgacggaagaaaagtttcaactcggccggcatctattctatgacaag
cgactctccgtcaatggcaccatcagctgctccagctgccaccaccaggacaaagccttt
agtgatggcgttgaccgccccgctggcgccaccggcacacttcacccgcgtaacagccaa
gcgttggtgaatgtggcctggtacaacaccctcacctggggcaacccagtgctcagcacc
attgaacagcaaattatgctgcccctgtttggtgatgaccctatcgaacatggcatcaat
ggcgctaactcggaacagattctcatgaatctgcaatccgaccctgtctatgcgccgttg
tttgcagcggcctttcctgagcaggatgagccgttatttggcgacactgcctatagcaac
atcgtcaaatcattggcttcctttgtgcggggtttggcgtcgttcaatagcccgtttgat
cgcaatgagctatccgcctcagccaagcgcggttccgccctgttcaacagtgaaaagctg
gaatgttttcattgtcatggaacctacaatttcagcgatgccacagtggaccgtcgcacc
agttatatcgaagcacaattccacaacaatggtctgtacaacatcgatggccttggaggc
taccccgaacccaataccggtcgctacgaactgaccggcaaagcccatcacatgggtcag
ttcagggctccctcgttaagaaacgtagccctcagcgccccctataaccacgacggttcc
gtggaaacgctggaacaggtgatacgcaactacgcggcaggtgggcgcaacattaccagc
ggccctaatacaggcgacgggcgcatgagcccatacaaagatagctttatcgtttctttc
tctatttccgattctgaaatagccgatgtggtggctttcctggaatcgctcaccgacgaa
gaattcattaataacccgcgtttttccaacccctggaccgagagcagcccgcaggacacc
accccatga

DBGET integrated database retrieval system