KEGG   Alcanivorax borkumensis: ABO_2459Help
Entry
ABO_2459          CDS       T00380                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
abo  Alcanivorax borkumensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:abo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2783307..2784317
Genome map
AA seq 336 aa AA seqDB search
MSVTRASWPATRMRRMRRDDFSRRLMREHTLTVDDLIYPVFVLEGSNQIEAVPSMPGVER
KSIDLLVEEARELADLGVPAMALFPVTPGDIKTLDGREAWNPEGLAQRAVRAIKAAVPEM
GVITDGALDPFTTHGQDGIIDDNGYVLNDVTVDALVKQALSHADAGADMVAPSDMMDGRI
GAIRDALEAHGHIHTRIMAYSAKYASAYYGPFRDAVGSAGNLGKADKTTYQMDPANSDEA
LHEIALDLAEGADVVMVKPGMPYLDVVRRVKDEFKVPVYAYQVSGEYAMHMAAFQNGWLD
QDKVMMESLLAFKRAGADGILTYFAKTAAQALKKQR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcacccgtgcttcctggcccgccacacgtatgcgccgcatgcgccgcgatgat
ttttcccgccgcctgatgcgcgagcacaccctcaccgttgacgacctgatttacccggtg
tttgtactggaaggcagcaatcaaatcgaagccgttccctccatgcccggtgtggaacgt
aaaagcattgatctgctggtggaagaagcccgtgagctggccgatctaggcgttcccgcc
atggccttgtttccagtcaccccaggcgatataaaaaccctcgatggccgtgaagcctgg
aaccctgaggggctagcccagcgtgccgtgcgcgcgatcaaggcagccgttcccgagatg
ggagtcatcactgacggcgccttggatccgttcactacccacggccaggacggcatcatt
gatgacaacggctatgtactcaacgacgtgaccgtggatgcactggtcaagcaggcccta
tcccatgccgacgccggcgccgacatggttgccccttcagacatgatggatggccgcatc
ggggccattcgcgatgccctggaagcccacggccatatccacacccgtatcatggcctac
tctgccaagtacgccagcgcctactatggccctttccgcgatgcggtcggctccgccggc
aatctcggcaaggcggacaagaccacctatcaaatggacccagccaattccgatgaggcg
ctgcatgagatcgccttagacctggcggaaggcgccgacgtggtaatggtgaaaccgggc
atgccttacttggacgtggtccgccgagtgaaagacgaattcaaagtccctgtgtacgcc
tatcaagtgagtggcgaatacgccatgcacatggccgcttttcaaaacggctggctggac
caagacaaagtgatgatggaatccttgctggcattcaaacgcgccggcgccgatggcatc
ctcacctactttgccaaaacggcagcgcaagcactgaaaaaacagcgttaa

DBGET integrated database retrieval system