KEGG   Alcanivorax borkumensis: ABO_2483Help
Entry
ABO_2483          CDS       T00380                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00010  Glycolysis / Gluconeogenesis
abo00071  Fatty acid degradation
abo00350  Tyrosine metabolism
abo00625  Chloroalkane and chloroalkene degradation
abo00626  Naphthalene degradation
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABO_2483
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_2483
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABO_2483
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABO_2483
   00626 Naphthalene degradation
    ABO_2483
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABO_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N DUF3538
Motif
Other DBs
NCBI-ProteinID: CAL17931
UniProt: Q0VLL7
Position
2816365..2817375
Genome map
AA seq 336 aa AA seqDB search
MKAIGFNRPRAIEDVHALEDIQLDLPSPAPRDLLVAVHAISVNPIDTKLRQRPLEQPGYR
VLGFDAAGVVEAVGEEVENFNVGDRVWYAGAVQRQGSNAQYQCVDERLVAKKPNSLGMQE
AAALPLTTLTAWEALEDQLGFQAGECEGKSVLVIGGAGGVGSIAIQLAAHYFGLKVITTA
GRETSANWCQSLGAHHIVDYRKPLLAQLDAIGCPQIDGIFITQNLDDYWATACQAVAPLG
GICAIVDARAPLDLNPLKAKSARFSWEFMFTRAMFATDMQHQGDILTRLSELVDQGTVQT
TVSEGLGTINAANLKEAHRRLESGNTVGKLVLAGWD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccattggattcaatcggcccagagccatagaagatgtacacgccctggaggac
atccagctggaccttccctcgcccgccccccgggacctactggtggccgtacacgctatc
tcggtcaaccccattgataccaagcttcgccaacgccccctggagcagcccggttaccgg
gtactggggtttgatgctgccggcgtggtggaagcggtgggcgaggaagtggaaaacttc
aacgtcggcgaccgggtctggtatgccggcgccgtgcaacgccagggcagcaatgcccag
taccagtgtgttgatgaacggctagtggcaaaaaaaccgaatagcctgggcatgcaagaa
gcggctgcactccccctcaccacactaaccgcctgggaggccctggaagatcagctcggt
tttcaagccggagagtgtgaggggaaaagtgtgctggtgatcggtggcgcaggaggagtg
gggtccatcgctatccagctagccgcccactattttggtcttaaggtgatcaccactgcg
ggtcgcgaaacctctgccaactggtgtcaaagcctcggcgctcatcatatcgtggactac
cgcaagccattactagcacagctggacgccattggttgcccgcagattgacggcatcttc
attacccaaaatctggacgactattgggccactgcctgccaagccgtcgcaccgctggga
ggcatctgcgctatcgtcgacgcccgtgcgcctctcgacctgaacccccttaaggccaag
agcgcgcgcttcagctgggaattcatgttcacccgcgccatgttcgctaccgacatgcag
catcaaggcgacatccttacccggctcagcgaactagtggatcaaggcacagtccagacc
accgtcagcgaaggcctgggcaccattaatgccgccaacctgaaagaagcccaccggcgg
ctggagtctggcaacacagtggggaaactggttcttgctggctgggactaa

DBGET integrated database retrieval system