KEGG   Alcanivorax borkumensis: ABO_2638Help
Entry
ABO_2638          CDS       T00380                                 

Gene name
GSHPx
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00480  Glutathione metabolism
abo00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ABO_2638 (GSHPx)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABO_2638 (GSHPx)
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABO_2638 (GSHPx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAL18086
UniProt: Q0VL62
Position
complement(2984402..2984878)
Genome map
AA seq 158 aa AA seqDB search
MGIYDYSAITLSGEEKSLADFQGKVLLIVNTASKCGFTPQYKGLEALYKTLQPKGLEVLG
FPCNQFGKQEPGAADEIGAFCEKNYGVSFTMFDKVDVNGGDAHPLYDFLKKEAPGVLGSK
GIKWNFTKFLVNKDGKVVKRYAPTDKPEAIQKDIEALL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggggatctatgattacagcgccattaccctgagtggtgaagaaaagtccctggccgat
tttcaaggcaaggtgctgctgatcgtcaatacggccagcaagtgtggttttacgcctcag
tacaaagggctggaggcgctgtataaaacgttgcaaccaaaagggctggaggttctcgga
ttcccctgtaaccagtttggtaaacaggaaccaggggcggcggatgaaattggtgccttt
tgtgaaaagaattacggtgtcagcttcaccatgttcgataaggtggatgtgaatgggggc
gatgctcacccgttgtatgattttctgaaaaaggaagctccgggcgtattgggtagcaag
ggtatcaagtggaacttcactaagttcctagtaaacaaggacggcaaggtggtgaagcgt
tacgcccctactgacaagccggaagcaattcaaaaggatattgaagcgcttctgtag

DBGET integrated database retrieval system