KEGG   Alcanivorax borkumensis: ABO_2638Help
Entry
ABO_2638          CDS       T00380                                 

Gene name
GSHPx
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abo  Alcanivorax borkumensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:abo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:abo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2984402..2984878)
Genome map
AA seq 158 aa AA seqDB search
MGIYDYSAITLSGEEKSLADFQGKVLLIVNTASKCGFTPQYKGLEALYKTLQPKGLEVLG
FPCNQFGKQEPGAADEIGAFCEKNYGVSFTMFDKVDVNGGDAHPLYDFLKKEAPGVLGSK
GIKWNFTKFLVNKDGKVVKRYAPTDKPEAIQKDIEALL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggggatctatgattacagcgccattaccctgagtggtgaagaaaagtccctggccgat
tttcaaggcaaggtgctgctgatcgtcaatacggccagcaagtgtggttttacgcctcag
tacaaagggctggaggcgctgtataaaacgttgcaaccaaaagggctggaggttctcgga
ttcccctgtaaccagtttggtaaacaggaaccaggggcggcggatgaaattggtgccttt
tgtgaaaagaattacggtgtcagcttcaccatgttcgataaggtggatgtgaatgggggc
gatgctcacccgttgtatgattttctgaaaaaggaagctccgggcgtattgggtagcaag
ggtatcaagtggaacttcactaagttcctagtaaacaaggacggcaaggtggtgaagcgt
tacgcccctactgacaagccggaagcaattcaaaaggatattgaagcgcttctgtag

DBGET integrated database retrieval system