KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_00062Help
Entry
ABTJ_00062        CDS       T02045                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:abr00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66633..67277
Genome map
AA seq 214 aa AA seqDB search
MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNH
ISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHI
DSYSAFMEADHSTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDA
CKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaataaacaaccacaaaattcggctttagtcgtagttgacgtgcaaaatggt
tttacccctggcggaaacctagcagttgccgacgctgatacgattattccaaccattaac
caattggcaggttgttttgaaaatgtagtcctcactcaagactggcatccggataatcat
atttcttttgcagccaaccatccgggcaagcagccatttgaaacgattgaactggattat
ggatcacaggtgctttggcctaagcattgtatacaaggcactcatgatgccgaatttcat
ccggatttaaatatcccgacagctcaactgattatccgaaaaggttttcatgctcatatt
gatagttactcggcttttatggaagccgaccactcaacaatgacaggtttaactggttac
ttaaaagaacgtggtattgatacggtctatgtggtcggaattgctacagacttttgtgtc
gcatggactgctttagatgcggttaagcaaggctttaaaactttagtaattgaagatgcg
tgcaaaggtattgatcttaatggttcattagaacaagcgtggcaaactatgcagcaacaa
ggtgttgttcgtattcaatcgactgatctgttgaatgaatgctag

DBGET integrated database retrieval system