KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_00292Help
Entry
ABTJ_00292        CDS       T02045                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:abr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:abr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
305157..306656
Genome map
AA seq 499 aa AA seqDB search
MTVSFQEIHPIEIDAQWPQQPFHGFSLDSRKVETGQIFIALTSYSQPEKTRTFAEAALAN
GALAVISETELGVANEWVCPDVRQRMGEWQKRYLQQADVVKPLRIIAVTGTNGKTTISRL
IAELISSQQQRCAVMGTTGNGILPNLTPSTHTTLDALQLQNALHDYAKQGATFASLEASS
HGLEQGRLNGCDIEIAVYSNLSRDHLDYHGTLEAYAEAKARLFQFNSLKVAVINLDDAHA
DLMIKSAQNNPAQPKILTYSLTQNTADYYITDLSYSLAGATFNLVSQQGSFAVESPLLGH
FNVENLIAALIAAEQAGFDLQALVNFVPKLIGAPGRMQVIRDDERLFVVDYAHTPDALIQ
VLKTLKRHVSNQLWAVFGCGGDRDRGKRPLMTQAALDGANPVILTSDNPRTEDPEQIFAD
MKQGIDFSGHRMHEIHDRREAIKFVAEQAQAGDIVVIAGKGHENYQEINGVRHWFDDVVE
VRSAIDAQHHTVDAAYPAQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttcttttcaagaaattcatccaatcgaaattgatgctcaatggcctcaacag
ccatttcacggctttagtttagatagtcgtaaagttgaaacgggccaaatttttattgct
ttgacaagttatagccagcctgaaaaaacgcgtacatttgctgaagcggctttagcaaat
ggagcgttggctgtcattagcgaaaccgaattaggtgtagcaaatgaatgggtatgccct
gatgtgcgtcagcgcatgggagagtggcaaaaacgttatttgcaacaggctgatgtagta
aaacctttacggattatagctgtaacaggcacaaatggtaaaacaacaatttctcgttta
attgctgagttaattagttcacagcagcagcgctgtgcagtgatggggacaacagggaat
ggtattttacctaacttaacgccttctacgcatactaccctcgacgctctacagttacaa
aatgcgctacatgattatgctaaacagggagcaacttttgcttctttagaagcaagttca
catggtcttgaacagggtcgattaaatggttgcgatattgaaattgctgtttatagcaac
ttaagtcgtgaccatctggattatcatggcactttagaagcttatgcagaagcgaaggcg
cgtttatttcagtttaattcgttaaaagtcgctgttattaatttagatgatgcgcatgct
gacttgatgattaagtctgcccaaaataatccagcacaacctaaaattttgacttactca
ctaactcaaaatacagctgattattacattaccgatttaagctatagcttggcgggtgca
acttttaatttagtaagtcagcaaggttcatttgcggtagaaagcccattattaggtcat
ttcaatgttgaaaatttaattgccgcactcatcgctgctgagcaagctggtttcgattta
caggcattggttaattttgttcctaaactaattggtgcgccaggccgaatgcaagttatt
cgtgatgatgagcgattatttgtagtggattatgcgcatacaccagatgcattgattcaa
gtgcttaaaacattaaagcgtcatgtttcgaatcagctttgggcggtgtttggatgtggt
ggtgaccgtgaccgtggtaagcgtccactcatgactcaagcagctttggatggcgcaaat
cctgttattctgacttcagataatccaagaacagaagaccctgaacaaatttttgctgac
atgaagcaaggaatcgatttttcagggcatcgtatgcatgaaattcatgaccgccgtgaa
gcaattaaatttgttgcagagcaagctcaagctggtgacattgtagtgattgccggcaaa
ggacatgaaaattatcaagaaattaatggtgtgcgtcactggtttgatgatgtggttgaa
gtgcgttccgcgattgatgcccaacatcatacggtagatgctgcttaccctgcacaatag

DBGET integrated database retrieval system