KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_00787Help
Entry
ABTJ_00787        CDS       T02045                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABTJ_00787
Enzymes [BR:abr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ABTJ_00787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813249..814100
Genome map
AA seq 283 aa AA seqDB search
MQLISLPKQILQCGQLQLDLSQPHVMGILNVTPDSFSDGGKHNQLDQAVDHALSMIEQGA
TIIDIGGESTRPGASEVVVEEEVRRVVPVVEALSHHNVILSIDTSQPEVIRAAKAAGAHI
WNDVRALTRPNALKTAVELDIPVVIMHMRGEPTTMNQLDQYTDVTLDVMQELQQRIDEAL
AAGVKKHNIIVDPGFGFAKNAQQNLKLLKEFWKLNELGYPILSGLSRKRFIGEALQGAPA
DQRAVGSVTGHLLSIQQGASIVRAHDVKEMHEAILVWKAMQQV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaatatctttaccaaagcagattttacagtgtggacagcttcaattagattta
tctcagccccatgttatgggtatcttaaatgtcactcctgattctttcagtgatggtggt
aaacataaccaattagaccaagcggttgatcatgcacttagtatgattgagcaaggcgcg
actattattgatattgggggggaatctacccgacctggtgcttcagaagttgtagtagaa
gaagaagtgcgtcgtgtggtacctgtggtcgaggctttatctcaccataacgttattttg
tcgatcgacacaagtcagccagaagttattcgcgcagcaaaagcagcaggggcacatatc
tggaatgatgtccgtgccttaacacgtcccaatgctttaaaaactgccgtagaattagat
atacctgtagtaattatgcatatgcgcggtgaaccaacgacaatgaatcagttggatcag
tacactgatgtaacactcgatgtgatgcaagagttgcaacagcgtattgatgaggctttg
gctgctggggtaaaaaagcacaatattattgttgatcctggatttggctttgcgaaaaat
gcccagcaaaatttaaaactattaaaagaattttggaaacttaatgaacttggttatcca
attttatccgggctttctcgtaaacgtttcataggtgaagctttacaaggcgctcctgca
gatcaacgtgctgtgggaagtgtaactgggcatttgcttagtattcagcagggagcatcc
attgtaagagcgcatgatgtaaaggaaatgcatgaagcaattttagtttggaaagcgatg
cagcaagtctga

DBGET integrated database retrieval system