KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_00940Help
Entry
ABTJ_00940        CDS       T02045                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABTJ_00940
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ABTJ_00940
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ABTJ_00940
Enzymes [BR:abr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ABTJ_00940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979334..980467
Genome map
AA seq 377 aa AA seqDB search
MIEVVDGQRKLSECKRIVVKIGSSLLTANGQGLDLDAISHWAKQIADLHNAGHEIILVSS
GAVAEGMVRMKLASRPTDLPSLQACAAIGQMGLIHTWSSVLENHSIRTAQVLLTHDDLAD
RRRYLNSCDALQNLIDWRVIPVINENDTVSTDEIRFGDNDTLAAMVAGQVHADLLIILTD
QQGMFDSDPRHNPDAKLLSTVRAMDDVLFEMAGGGGVLGRGGMVTKVRAARLAAKSGCPT
LIASGESDNVLSRVMAGEMLGTLFTTDKDRMTAHQQWLAAHLQTAGRLVIDDGAVEAIKL
KHRSLLPVGVKTVEGHFDRGDVVECVDKQGKRVAVGRVNFSSRSAEIIKGLSSDKVYQVL
GEARSLEMIHRDHMAIY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagtggtcgatgggcaacgtaagctcagtgagtgtaaacgaatcgttgttaaa
atcggatcatctttactcacggcaaatgggcagggtctagatctggacgctatttcgcat
tgggcgaaacagattgcagatttacacaatgctggacacgaaattattttagtgtcttca
ggagctgtggcagaaggtatggttcgtatgaagcttgcgagtcgacccaccgatctaccc
agtcttcaagcatgcgccgcaattgggcagatgggcctaattcatacttggtctagtgtg
cttgaaaatcatagtatccgaactgctcaggtgttgttaacacatgatgatttggcagac
cgccgtcgttacttaaattcatgtgatgcattgcagaacttgattgattggcgtgttatt
ccggtcattaatgaaaacgatactgtatctaccgatgagattcgttttggtgataacgat
acactagcagctatggttgctggtcaagtacatgctgatttattaattattttaacagat
cagcaaggtatgtttgattcagacccacgtcataatcctgatgcaaagttattatcaact
gtgcgtgccatggatgatgttttatttgaaatggctggtggtggcggtgtgcttggacga
ggtggcatggtcactaaagttcgtgctgcacgtttagctgccaagtcaggttgcccgaca
ttgattgctagtggtgaaagcgacaatgtgttgtcacgagtgatggctggtgagatgctg
ggtacattgtttacgactgataaagaccgtatgacagcgcatcagcaatggcttgctgca
catttacaaacagcgggtcgtcttgtaattgatgatggcgcagttgaagcgattaaattg
aaacatcgcagtttattgcctgttggggtaaaaactgttgaaggacattttgatcgtggt
gatgtggttgaatgtgtcgataaacaaggtaaacgtgttgcggttgggcgagtgaatttt
agctctcgttctgctgaaattattaaaggtctttcttcagacaaagtttatcaagtactt
ggtgaagcccgttcattagaaatgattcatcgcgatcatatggcaatttactaa

DBGET integrated database retrieval system