KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_01396Help
Entry
ABTJ_01396        CDS       T02045                                 

Definition
acyl-CoA synthetase/AMP-acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABTJ_01396
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABTJ_01396
   00620 Pyruvate metabolism
    ABTJ_01396
   00640 Propanoate metabolism
    ABTJ_01396
  Energy metabolism
   00680 Methane metabolism
    ABTJ_01396
Enzymes [BR:abr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABTJ_01396
Lipid biosynthesis proteins [BR:abr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABTJ_01396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1450546..1452189
Genome map
AA seq 547 aa AA seqDB search
MKTLAEAYQQFDLTRLIEEQLVGHPQAINAYVECCERYVGKYKTALIWEGKNGQAEHYTF
EQLAELSGKLANFFKAQGIQAGDCIAGLLPRTPELLITILATWRIGAIYQPLFTAFEAKS
IDHRITTAQTKLIVTNDEQRPKLNTLNVPVIVTVHQTGLLSEHDFDFWQSLQRYSEQCEP
VNRSFDDDFLMMFTSGTTGLAKSVPVPLKAILAFKGYMTHAVDLREEDMFWNLADPGWAY
GLYYGITGPLSLGHGIIMDERSFNVDQAIELIKKYKVSNLTGSPTAFRMFFGFKEKFDPS
IKQHLRVVSSAGEPLTPEVVNWFKQDLEVNIFDQYGQTELGMVIANHHALEHPLKVGSAG
FAIPGHRFAVLDQNYQELPTGGVGILAMDSEQSPLMWFKGYGGNNRKAFVGKYYLTGDTV
TLNEHGGIDFVGRADNVITTSGYRVGPFDVESTLLECEAVLESAVIGKPDPERTEIVKAF
VVLKPAYQACETLKDKLQQYVRNRLSRHAYPKEIEFVDSLPKTTSGKIQRGLLKQQEIAK
MQQAYAS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttggcagaagcttatcagcaatttgatcttacaaggctcatcgaagagcaa
cttgttgggcatccccaagcaataaatgcttatgttgagtgctgtgagcgttatgtagga
aaatataaaacagcgcttatctgggaagggaaaaacggacaggcagagcactatacgttc
gaacaacttgctgaactttctggaaaacttgctaacttctttaaagcacaaggaattcaa
gctggagattgtattgcaggacttctaccaagaacgcctgagttattaattacaattttg
gcaacgtggcgtataggtgctatttatcagcctttatttactgcctttgaagcaaaatcg
attgatcaccgaattacgactgctcaaactaaattgattgtgaccaatgatgaacagcgc
cctaaactgaataccttgaatgttccggttattgtaactgttcatcaaacaggtctttta
tctgagcatgactttgatttttggcaatctttacaacgatattctgagcaatgtgagcca
gtaaatcgtagctttgatgatgactttttaatgatgtttacctcaggcacaactggactt
gcgaagtctgtacctgttccactaaaagcaattttagcatttaaaggttatatgacccat
gccgttgatttgcgtgaagaggatatgttctggaatctggcagatccgggctgggcatat
ggtttgtattatggcattaccgggcctttaagcttgggtcatggcattattatggatgag
cgttcatttaatgtagatcaggcaatagaattaattaaaaaatataaagtaagtaattta
acaggatcgcctacagcatttcgcatgttctttggatttaaggaaaaatttgacccttca
attaaacaacatttacgcgtagtgagcagtgcaggtgagccattaactcctgaggttgtg
aactggtttaagcaggatttagaggtcaatatttttgatcaatatggccaaactgagcta
gggatggtgattgcaaatcatcatgctcttgagcatccattaaaagtaggttcagctggt
tttgcaattcctggacatcgttttgcggtgttagaccaaaattatcaagaattgccaact
ggtggtgttggtattttggcaatggactcggagcaatctccattgatgtggtttaaaggt
tatggtggcaataatcgcaaagcctttgttggcaaatattatttaactggtgacacggtc
actttaaacgaacatgggggcattgattttgtgggacgtgctgacaatgtcattacaact
tcgggctatagagttggaccatttgatgttgaaagtactttgttagagtgtgaggcggta
ttagagtcagcagtaattggtaagccagatccggaacgaaccgaaatagtcaaagctttt
gtggtacttaagcctgcttatcaagcgtgtgaaacattaaaagataagttacagcaatat
gttcgtaaccgtttatctcgtcatgcttatccaaaagagattgagtttgtggacagtcta
ccgaaaaccacgagcggaaaaattcaaagaggactgttgaagcagcaagaaattgcaaaa
atgcagcaagcctacgcaagctaa

DBGET integrated database retrieval system